KEGG   Galdieria sulphuraria: Gasu_62530Help
Entry
Gasu_62530        CDS       T02926                                 

Definition
elongator complex protein 3 (EC:2.3.1.48)
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
gsl  Galdieria sulphuraria
Brite
Enzymes [BR:gsl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Gasu_62530
Transfer RNA biogenesis [BR:gsl03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    Gasu_62530
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 566 aa AA seqDB search
MELLHVNDGHAATLEKPPVFDKETKRVSPHVARMTAISELVTEIRKLFEDGQPIQLQKLI
SNVSKKHSLEEFPKLMEILAAVPNDMRAKLYPVLKAKPVRTASGIAIVAVMSKPHRCPHI
ATTGNICIYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPYLQVKNRIEQLKGLGHSV
DKVEFILMGGTFMSLDAEYRDYFIRNLHDALSGHHSRDTYEAVMYSERSHQKCIGLTIET
RPDFCHRPHLNAMLSYGCTRLEIGVQSVFEDIARDTNRGHSVQAVCDCFCLSKDAGFKVV
AHMMPDLPNTGFERDLESFREFFENPSFRTDGLKIYPTLVIRGTGLYELWKAGKYKNYPP
GVLVELIARVLAMVPPWVRIYRIQRDIPMPLVSSGVEVGNVRELALARLRELGLSCRDVR
TREVGIQQTHFHIIPECVELVRRDYVANGGWETFLSFEDVTQDILVGLLRLRKCSSLAFR
PELTEFPSSIVRELHVYGTVVPVHDRDPTKFQHQGIGKLLMEEAERIALEEHGSEKLAVI
SGIGTRNYYRKLGYVLQGPYMVKYLI
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atggagttgcttcatgtaaatgacggccacgctgccactcttgagaaacctccagttttt
gataaagaaaccaaaagggtttctcctcatgttgcgagaatgactgccatttcagaacta
gtaacagaaataaggaagctttttgaagatgggcaacctatccagttacaaaagcttatc
tcaaacgtctccaagaaacattcacttgaagagtttcctaaacttatggagattcttgca
gccgtgccaaacgatatgagagcaaagttatatcctgtgttaaaagcgaaaccagtgcgc
actgcttcaggaattgcaatcgtggccgttatgagtaaaccccatcgctgtcctcatatt
gcaacaaccggaaacatatgtatatattgtccaggcggtccggattcagactttgagtat
tccactcaaagctatactggatatgagcctaccagtatgcgcgcaatacgggcacgttat
gacccttatcttcaggtgaaaaaccgaattgagcagctgaaaggtttgggccactctgta
gataaggttgaatttattctcatgggtggaacttttatgtcactggatgctgaatatagg
gactattttattcgtaacttgcatgatgccctgtctggtcaccattctagagatacctat
gaagctgttatgtactcagaaagaagtcatcaaaagtgcatcggtttgactattgaaact
cgtcctgacttttgtcatcgtcctcatttgaatgcaatgctgtcttatggctgtacgcga
ttagaaatcggcgttcaaagtgttttcgaagatatagcgagagatactaatcgtgggcat
tctgttcaagcggtttgcgactgcttttgtttgtcaaaagatgctggttttaaagtagtc
gctcatatgatgcccgacttgccgaacactggttttgaaagagacttggaaagttttcgt
gaattttttgaaaatccttcctttcgaacagatggattgaagatatatcccaccttagtc
ataagaggtacaggcctttatgagttgtggaaagcagggaagtataaaaattatccaccc
ggagttttagtggaacttattgcacgagttttagctatggttcctccttgggtgcgaatc
tacagaatccaacgagatattcctatgcctttggtttcatctggagtagaagttggtaat
gtaagggagttggctcttgcaagattgcgagaacttggactatcatgtcgcgatgttcgt
acacgagaagtaggcattcaacagacacatttccacatcattccagaatgtgttgaactg
gttcgtcgtgactatgttgcgaatggagggtgggaaacttttctttctttcgaagatgtc
acacaagacattcttgttggtcttttgcggttgagaaaatgcagttcgcttgcttttcgt
ccggaactcacagagtttcctagttcaatagtacgtgaacttcacgtgtatggaaccgtg
gttccagtccatgatagagatcccaccaagtttcaacatcaaggaataggaaagctatta
atggaagaagcagaaagaatagcactggaagagcatggctcagaaaaacttgcagtcatt
tcaggaatcggtacccgtaattattatagaaagttgggttatgtcctacaaggtccgtat
atggtaaaatatttgatataa

DBGET integrated database retrieval system