KEGG   Geobacter sulfurreducens PCA: GSU0012Help
Entry
GSU0012           CDS       T00155                                 

Gene name
hemY
Definition
(RefSeq) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
gsu  Geobacter sulfurreducens PCA
Pathway
gsu00860  Porphyrin and chlorophyll metabolism
gsu01100  Metabolic pathways
gsu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gsu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GSU0012 (hemY)
Enzymes [BR:gsu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     GSU0012 (hemY)
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     GSU0012 (hemY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO NAD_binding_9 Pyr_redox Thi4 FAD_binding_2 FAD_oxidored MCRA Trp_halogenase
Motif
Other DBs
NCBI-GeneID: 2685243
NCBI-ProteinID: NP_951074
UniProt: Q74H80
Position
complement(20295..21704)
Genome map
AA seq 469 aa AA seqDB search
MKKAIVAGGGISGLATAYLLKTRAAEEGLELDVTLVEREERLGGKIWSIKEEGYLCEWGP
NGFLDSKPQTLDLCRELGASDLLLRSNDNARKRFIYTGGALNRLPENGPMFLKSGLISWP
GKLRLAMEPFIPKKAGDEDETLAAFGRRRLGDEALRKLIAPMVSGIFAGNPETMSLRSCF
PRIAELEDEYGSLVRAMIRLAKKKKQEVAQGKAVASAAGPGGVLTSFRDGIQALTDILAE
RLGPDTIVSGQEVLEVSRGGSLPWRVRTGSIDMDADLVILATPAYATASIIQGVDSDMAG
ILRQIPYATMTVVCFGYDRERIAHDLNGFGYLIPKEEGMNTLGTLWDSSIFENRAPEGQV
LLRSMMGGACFPEYVNLTDEEVTGRVKNDLATIMGITAPPSFVRIFRHHQAIPQYTVGHS
TRVAALEQRAASLPGLFLTGNSYRGIGLNDCVAAANRTAGEAIAQLTSR
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaggcgattgtggccggcggcggcatctcagggctcgccaccgcgtacctgctg
aaaacccgggccgcggaggaaggacttgagctcgacgtgaccctggtggagcgggaggaa
cgcctggggggcaaaatctggagcatcaaggaggaggggtatctctgcgagtggggcccc
aacggttttctggactccaaaccccagaccctcgacctctgccgggaactgggcgcgtct
gacctgctcctgcggagcaacgacaacgcccgcaagcggttcatctacaccggcggggcg
ctgaaccgcctacccgagaacggacccatgtttctcaaaagcggtctcatctcctggccg
ggcaagctgcggctcgccatggaaccgttcattccgaaaaaagcgggcgacgaggacgaa
accctggcggccttcggccggcgccgcctgggggacgaagcgctgcgcaagctgattgcg
cccatggtgtcggggatttttgccggcaatccggaaaccatgtccctgcggtcgtgcttt
ccccgcatcgccgagttggaggatgaatacggcagcttggtgcgggccatgatccgtctg
gcgaaaaagaagaagcaggaggtcgctcaaggaaaggcggtggccagcgccgccggaccg
ggcggggtgctcacctcgttccgggacggcatccaggccctcaccgatatcctggccgag
cgtctcggtccggacactatcgtatcgggccaggaagtgctggaagtttcgcggggcgga
agcctcccctggcgggtgcggaccggaagcatcgatatggacgccgatctggtgatcctg
gcgacccccgcctatgccaccgcctccatcattcagggagtggactccgacatggccggc
attctccggcagatcccctacgccaccatgaccgttgtctgcttcggatatgaccgggag
cggatcgcccacgatctgaacggcttcggctatctcattccaaaggaggaggggatgaat
accctgggcacgctctgggattcgagcatcttcgagaaccgggcgccggaaggtcaggtc
ctcctgcgcagcatgatggggggggcctgcttccccgaatacgtcaacctgaccgacgag
gaggtcactgggcgggtgaagaacgacctcgccaccatcatgggcatcacggcgcctcct
tcgttcgtccgcatcttccgccatcaccaggccatcccccagtacaccgtggggcactcc
acacgcgtagccgctctggagcagagagccgcctccctgccgggacttttcctcaccggc
aactcttaccggggtatcggcctcaacgactgcgtggccgccgccaaccgcaccgccggc
gaggccatcgcccagctcacatcccgctga

DBGET integrated database retrieval system