KEGG   Geobacter sulfurreducens PCA: GSU0096Help
Entry
GSU0096           CDS       T00155                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
gsu  Geobacter sulfurreducens PCA
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:gsu03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
109095..109688
Genome map
AA seq 197 aa AA seqDB search
MVHFSDSLSRLLAELQKLPGVGEKTALRLAFHLLKSPDNAAALADSLRDVMSRVRFCSVC
FGITEDDPCRFCSDARDDGAICVVEEPQDLLAVERTRAFRGRYHVLQGALSPLNGVTPDR
LRVAELMKRLEGGGVREVVIATNFTVEGEATALYLARMIKPLGVRVTRLAHGIPLGSDLE
FVDAATVQRALEGRSEL
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atggtacatttttcagactcattgtcacggttgctcgcggaactgcaaaagctgccggga
gttggcgagaaaaccgccctgcgcctcgcctttcatcttttgaaatcccccgacaacgcc
gctgccctggctgacagtcttcgggacgtcatgtcccgggtgcggttctgttccgtctgt
ttcggcattaccgaggacgatccctgccggttttgctccgatgcccgagatgacggtgcc
atctgcgtcgtcgaggaaccccaggaccttctggccgttgagcggacccgagccttcagg
gggcgttatcatgtgctccagggggcgctgtccccgctcaacggtgttacccccgaccgg
ctccgcgttgcggagctcatgaagcggctggaggggggaggggttcgggaagtggttatt
gccaccaacttcaccgtggagggcgaagcaaccgcgctctatctggccaggatgatcaag
cccctgggggtcagggtgacacgactcgcccacgggataccgctcggcagcgatctggag
ttcgtggatgcggccacggtgcagcgggcgctggaaggacggagcgagctgtaa

DBGET integrated database retrieval system