KEGG   Geobacter sulfurreducens PCA: GSU0293Help
Entry
GSU0293           CDS       T00155                                 

Gene name
cheB64H-1
Definition
protein glutamate methylesterase CheB associated with MCPs of classes 40H and 40+24H, response receiver domain-containing
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
gsu  Geobacter sulfurreducens PCA
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:gsu00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    GSU0293 (cheB64H-1)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    GSU0293 (cheB64H-1)
Enzymes [BR:gsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     GSU0293 (cheB64H-1)
Two-component system [BR:gsu02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   GSU0293 (cheB64H-1)
Bacterial motility proteins [BR:gsu02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    GSU0293 (cheB64H-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(321950..323038)
Genome map
AA seq 362 aa AA seqDB search
MLQNQTRKLRVLVVDDSSFMRMVIRSVLEKDPAIEVVGIAVDGMEGVEKALALKPDLITM
DIEMPRLDGISALKQVMAKCPTRVLMVSTLTCEGAKATFDALDAGAIDYIPKNVTDSADA
QRVFREELLRKVKGAASSIFGRPMTTSAPRAIIAPPRQVQPAPRPSQALAGKFHYVGIGA
STGGPVALQEVLGRIPGNYPHGIVVAIHMPKAFTGPYAERLNSKCSLQIKEANDGDIIQP
GVVLVAPGGRHMALARQGNSIVVRTLSTAECPQYIYIPSVDHMMTTLADATNGSALGVIL
TGMGSDGFKGMKHLKSKGGITIVQDEATSTIYGMPRACIEGGVADTVLPLTQIGSEIARL
GG
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgcttcagaatcagacacgaaaactgcgagtcctggtcgtcgacgattcttctttcatg
aggatggtgatccggagcgtactcgaaaaggacccggcgatcgaggtggtcggcatagcc
gttgatgggatggaaggggttgaaaaagccctggccctgaaaccggacctgatcaccatg
gacatcgagatgccacggctggacgggatctccgccctcaaacaggtcatggccaagtgc
ccgacacgggtcctgatggtctcaaccctcacctgcgagggagccaaggccacctttgac
gccctcgatgcaggcgccatcgactacattccgaaaaacgtgaccgacagcgccgatgcc
cagcgagtcttccgggaagagttgctgcgcaaggtcaagggagccgccagctctatcttc
ggccggccgatgaccacatcggccccccgggcgatcatcgctcccccccggcaggtgcag
cccgctccgcgcccctcgcaggcattggccggcaagttccactacgtgggcattggcgcc
tccaccggcggcccggtggcgctccaggaggtcctgggccgcatccccggcaactacccc
catggcatcgtggtggccatccacatgcccaaggcattcacggggccctacgccgaacga
ctcaacagcaagtgttccctccagatcaaggaggcgaatgatggcgacatcatccagccc
ggcgtggtcctcgttgccccgggcggtcgtcacatggcgctggcccgccagggaaactcg
atcgtggttcggacgctctccaccgccgagtgcccccagtacatctacattccgtcggtg
gaccacatgatgaccaccctggctgacgccaccaacggatcggccctgggagtgatcctt
acgggcatggggagcgacggattcaaggggatgaagcacttgaaaagcaagggtggcatc
accatcgtccaggacgaggccacctccaccatctacggcatgccgcgggcctgcatcgag
gggggcgtcgcagacacggtgcttcccctcacccagatcggttcggagatcgcccgtctg
ggtgggtga

DBGET integrated database retrieval system