KEGG   Geobacter sulfurreducens PCA: GSU0293Help
Entry
GSU0293           CDS       T00155                                 

Gene name
cheB64H-1
Definition
protein glutamate methylesterase CheB associated with MCPs of classes 40H and 40+24H, response receiver domain-containing
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
gsu  Geobacter sulfurreducens PCA
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:gsu02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:gsu02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(321950..323038)
Genome map
AA seq 362 aa AA seqDB search
MLQNQTRKLRVLVVDDSSFMRMVIRSVLEKDPAIEVVGIAVDGMEGVEKALALKPDLITM
DIEMPRLDGISALKQVMAKCPTRVLMVSTLTCEGAKATFDALDAGAIDYIPKNVTDSADA
QRVFREELLRKVKGAASSIFGRPMTTSAPRAIIAPPRQVQPAPRPSQALAGKFHYVGIGA
STGGPVALQEVLGRIPGNYPHGIVVAIHMPKAFTGPYAERLNSKCSLQIKEANDGDIIQP
GVVLVAPGGRHMALARQGNSIVVRTLSTAECPQYIYIPSVDHMMTTLADATNGSALGVIL
TGMGSDGFKGMKHLKSKGGITIVQDEATSTIYGMPRACIEGGVADTVLPLTQIGSEIARL
GG
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgcttcagaatcagacacgaaaactgcgagtcctggtcgtcgacgattcttctttcatg
aggatggtgatccggagcgtactcgaaaaggacccggcgatcgaggtggtcggcatagcc
gttgatgggatggaaggggttgaaaaagccctggccctgaaaccggacctgatcaccatg
gacatcgagatgccacggctggacgggatctccgccctcaaacaggtcatggccaagtgc
ccgacacgggtcctgatggtctcaaccctcacctgcgagggagccaaggccacctttgac
gccctcgatgcaggcgccatcgactacattccgaaaaacgtgaccgacagcgccgatgcc
cagcgagtcttccgggaagagttgctgcgcaaggtcaagggagccgccagctctatcttc
ggccggccgatgaccacatcggccccccgggcgatcatcgctcccccccggcaggtgcag
cccgctccgcgcccctcgcaggcattggccggcaagttccactacgtgggcattggcgcc
tccaccggcggcccggtggcgctccaggaggtcctgggccgcatccccggcaactacccc
catggcatcgtggtggccatccacatgcccaaggcattcacggggccctacgccgaacga
ctcaacagcaagtgttccctccagatcaaggaggcgaatgatggcgacatcatccagccc
ggcgtggtcctcgttgccccgggcggtcgtcacatggcgctggcccgccagggaaactcg
atcgtggttcggacgctctccaccgccgagtgcccccagtacatctacattccgtcggtg
gaccacatgatgaccaccctggctgacgccaccaacggatcggccctgggagtgatcctt
acgggcatggggagcgacggattcaaggggatgaagcacttgaaaagcaagggtggcatc
accatcgtccaggacgaggccacctccaccatctacggcatgccgcgggcctgcatcgag
gggggcgtcgcagacacggtgcttcccctcacccagatcggttcggagatcgcccgtctg
ggtgggtga

DBGET integrated database retrieval system