KEGG   Geobacter sulfurreducens PCA: GSU0573Help
Entry
GSU0573           CDS       T00155                                 

Definition
zinc-containing alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
gsu  Geobacter sulfurreducens PCA
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:gsu00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    GSU0573
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GSU0573
  Lipid metabolism
   00071 Fatty acid degradation
    GSU0573
  Amino acid metabolism
   00350 Tyrosine metabolism
    GSU0573
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    GSU0573
   00626 Naphthalene degradation
    GSU0573
Enzymes [BR:gsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     GSU0573
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
601208..602200
Genome map
AA seq 330 aa AA seqDB search
MRAMLFEEVGKPLRPVRVPVPEPGPGEVLLKVHACGICRTDVHIVDGELTEPALPLIPGH
QIVGSVAKLGEGVERFREGTRVGVPWLGATCGACRYCRSGRENLCDHARFTGYQRDGGFA
EFTVADARFCFPIPGGYPDLQAAPLLCAGLIGYRSLVMAGEGERLGIYGFGAAAHIVTQV
ARFRGWRVYAFTRPDDRAGQAFAREMGAVWAGASHERPPEELDAAIIFAPAGELVPAALR
AVGKGGVVVCGGIHMSDIPPIPYDILWGERSIRSVANLTRRDGEEFLALAPKVPVRTEVT
AYPLSAANEALDDLRRGRLRGAGVLVIDEG
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccatgctgttcgaggaggtgggaaaaccgctgcggccggtccgggtgccggtc
cccgaaccggggccgggcgaggtgctgctcaaggttcacgcctgcggtatctgccggacg
gatgttcacatcgtggacggcgagctgacggagcccgccctgccgctcatccccggccac
cagatcgtggggagcgtggcaaagctgggggagggggtcgagcgtttccgggaggggacg
cgggtgggggtcccctggctcggcgccacctgcggcgcctgccgctactgccggtcggga
cgggaaaacctgtgcgaccacgcccggttcaccgggtatcagcgcgacggcggctttgcc
gagttcaccgttgccgatgcccgcttctgctttccgatccccgggggatacccggacctc
caggcggcgccgctgctctgcgccgggctcatcggctaccgctccctggtcatggccggt
gagggggaacggctgggcatttatggcttcggcgccgcggcccacatcgtgacccaggtg
gcccgcttccggggatggcgggtctacgccttcacccgtcccgacgaccgtgccggccag
gcctttgcccgggagatgggagcggtctgggccggggcctcccacgagcggccgcccgag
gagcttgacgccgccatcatcttcgcgcccgccggagagctggtgccggcggcgctgcgg
gcggtgggcaaggggggcgtcgtggtctgcggcggcatccacatgagcgacatcccgccg
atcccctacgatatcctctggggggagcggagcatccgctccgtggccaacctgacccgg
cgcgacggggaggaattcctcgccctggcgccgaaggtgcccgtcaggaccgaggtgact
gcctatcccctcagcgcggccaacgaagccctcgacgacctgcggcgcgggcgcctgcgg
ggcgccggcgtcctggtgatcgacgagggataa

DBGET integrated database retrieval system