KEGG   Geobacter sulfurreducens PCA: GSU0660Help
Entry
GSU0660           CDS       T00155                                 

Gene name
ispE
Definition
(RefSeq) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
gsu  Geobacter sulfurreducens PCA
Pathway
gsu00900  Terpenoid backbone biosynthesis
gsu01100  Metabolic pathways
gsu01110  Biosynthesis of secondary metabolites
gsu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:gsu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    GSU0660 (ispE)
Enzymes [BR:gsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     GSU0660 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N DUF3110
Motif
Other DBs
NCBI-GeneID: 2685508
NCBI-ProteinID: NP_951717
UniProt: Q74FE9
Position
696962..697801
Genome map
AA seq 279 aa AA seqDB search
MKKLTLKAPAKVNYRLDVLRRRPDGYHDLRMIMQRIDLCDEIEICLTDGPGIRVVCGREG
VPDGPGNIAWRAADALLALSADKPGIDISITKKIPVAAGLGGGSSDAATVLMGVNELLGL
DLPEKRLREIGVTLGADVPFFIFGRTALAEGIGEELTAIDRVPAAWIVVVNPNVPVSTAW
VYQNLQLTGEAARVKIPRFFESVAEVCAILSNDLESVTIPRYPVIGEIKRELLAAGALGS
LMSGSGPTVFALFEEEDAAVRAAEMMRARSWFAAAVRTI
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaagctgacgctcaaggccccggccaaggtcaattaccgcctcgacgttctgagg
cggcgccccgacggctaccatgatttgcggatgatcatgcagcggatcgatctctgtgac
gagatagagatctgcctcacggacgggcccggcattcgggtggtctgcggccgcgagggg
gtgcctgatgggcccggcaatattgcctggcgcgctgctgacgccctgctcgccctgtcc
gccgacaagcctggtattgatatctccataaccaagaagattccggtggcggccggcctg
ggaggcggaagcagtgacgcggcgacggtgctcatgggggtgaacgagctgctgggactg
gatctgcccgaaaagcgtctccgggagatcggcgtcaccctcggcgctgacgtgccgttt
ttcatcttcggccggacagccctggccgaagggatcggcgaggagctgaccgccatcgac
cgagtgcccgccgcctggattgtggtggtcaatcccaatgttcccgtttcgacggcatgg
gtctatcaaaatttgcaattgacaggtgaggccgccagggttaaaattccccgtttcttc
gagagtgtcgcggaggtctgcgcgattctctccaatgaccttgaatcggtcactatcccg
cggtatccggttatcggcgagatcaagcgtgagcttctcgccgccggggcgctcggttcc
ctcatgtcgggaagcgggccgacggtttttgcactcttcgaggaagaggacgcagccgtt
cgagccgccgagatgatgcgcgcgcggagttggttcgccgcagcggtcaggacaatctga

DBGET integrated database retrieval system