KEGG   Geobacter sulfurreducens PCA: GSU0687Help
Entry
GSU0687           CDS       T00155                                 

Gene name
hpnA
Definition
NAD-dependent nucleoside diphosphate-sugar epimerase/dehydratase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
gsu  Geobacter sulfurreducens PCA
Brite
Enzymes [BR:gsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     GSU0687 (hpnA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(724367..725353)
Genome map
AA seq 328 aa AA seqDB search
MKVFVTGATGFIGASIVRELLKDGCHVRVLARPGSDRRNLAGLDVEICEGDLRDRQALEH
GLAGCEVLYHAAADYRLWTRTPAAMYAANVDGTRNILEAALRRGIARVVYTSSVGTLGNP
GNGTPGTETTPVTFADMVGHYKKSKFLAEREAEAFIARGLPLVIVNPSTPVGPHDVKPTP
TGKIIVDFLNRKMPAYLDTGLNIIDVEDCARGHLLAARHGRIGEKYILGHENLTLREIFA
LLARLTGIPAPRVRLPHTPILMAAYVNEALAKLTGKEPLIPLAGVQMAKKFMFFESSKAT
GELGLQRRPAVDALRRAVEWFRANGYAR
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtttttgtcaccggcgcgaccggttttataggggcgagcatcgtccgggaattg
ctgaaggacggctgccacgtgcgggtgcttgcccgcccgggctccgaccgtcggaacctc
gcggggctggacgtggagatctgcgaaggggatctccgggatcggcaggcgctggagcac
ggccttgccggctgcgaggttctttaccacgccgccgccgactaccgactctggacccgc
acgccggcggcaatgtatgcggccaacgtggacggcacccgcaacatcctggaggcggcc
ctgcggcgcggcatcgccagggtggtctacaccagcagcgtaggcaccctcggcaatccc
ggcaacggcacccccggaaccgagacgacgccggtcaccttcgccgacatggtcggtcac
tacaaaaaaagcaagttcctggccgagcgggaagcggaggcgttcatcgcccggggtctc
ccgctggtgatcgtaaatccctccacgccggtgggcccccacgacgtgaagccgactccc
acgggcaagatcatcgtcgacttccttaaccggaagatgcccgcctacctggacaccggc
ctcaatatcatcgatgtggaggactgtgcccggggacacctgctggcggcacggcacggc
cggatcggtgaaaagtacatcctggggcacgagaacctgaccctgcgggagatcttcgcc
ctgttggccaggctcacggggattccggcgcccagggtgcggctcccccataccccgatt
ctcatggccgcttacgtgaacgaggcactggccaagcttacgggaaaagagccgctcatc
ccgttggcaggggtgcagatggccaaaaaattcatgttcttcgaatcgtccaaggcgacg
ggggagctggggctccaacgccgtcccgccgtggatgccctgcgcagggccgtggagtgg
ttccgcgccaacgggtatgcccggtga

DBGET integrated database retrieval system