KEGG   Geobacter sulfurreducens PCA: GSU0726Help
Entry
GSU0726           CDS       T00155                                 

Gene name
cheD64H
Definition
(RefSeq) protein glutamine deamidase and protein glutamate methylesterase CheD associated with MCPs of classes 40H and 40+24H
  KO
K03411  
chemotaxis protein CheD [EC:3.5.1.44]
Organism
gsu  Geobacter sulfurreducens PCA
Pathway
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:gsu00001]
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    GSU0726 (cheD64H)
Enzymes [BR:gsu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     GSU0726 (cheD64H)
Bacterial motility proteins [BR:gsu02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    GSU0726 (cheD64H)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
774341..774946
Genome map
AA seq 201 aa AA seqDB search
MRHQRLEGRHIIRIAPGEYHVTTGGGVISTLLGSCVAACLFDSESGVAGMNHFLLSNHRY
SRTMPFCFTEAGRYGIHSMELLINSLMRHGARRENLRAKAFGGASILVNRAEVGNFSCVG
SVNARFVREFLANEGIPLLSADLEGERGRVIYFDTTDFSVFVRKIRLQRSLVVAKRDRNV
WEHGVQAHDVEPDSVDLWLPG
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcatcaacgcctcgaaggccgtcacattatccgtatcgctcccggcgaataccac
gtcactacaggcgggggcgtcatttcgacgcttctcggttcgtgcgtggccgcctgcctg
ttcgactcggaaagcggcgtggccgggatgaatcattttctgctcagcaatcaccgctac
tcccgcaccatgcccttctgcttcaccgaggcggggcgctacggcatccactccatggaa
ctgcttatcaactctctcatgcgccacggtgcgcggcgggagaacctccgcgccaaggcc
ttcggcggtgcctcgattctggtcaatcgcgccgaggtcggcaacttttcctgtgtcggc
agcgtcaatgcccggtttgtccgggagtttctcgccaatgaagggattccgctcctctcc
gccgacctggagggggagcggggccgcgtgatctatttcgatacaacggacttttccgta
ttcgtccgcaagatccggctccagcggagcctcgtggtggccaagcgcgaccggaacgtg
tgggaacacggggtccaggcccatgatgtggaaccggactcggtcgacctctggctgccg
gggtag

DBGET integrated database retrieval system