KEGG   Geobacter sulfurreducens PCA: GSU0850Help
Entry
GSU0850           CDS       T00155                                 

Definition
protein disulfide bond isomerase, DsbC/DsbG-like protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
gsu  Geobacter sulfurreducens PCA
Brite
Enzymes [BR:gsu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     GSU0850
Secretion system [BR:gsu02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   GSU0850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
910013..910819
Genome map
AA seq 268 aa AA seqDB search
MTKRLINSCLVGALVAVLAAGSALASPKEGAKEESPEATIKALFPTLPLTSVKKTPIDGL
FEVITDGNVIYIYPKTGNVIIGNLFTKEGKNLTAEASNRLVADRYKLITAADKEKAVKVG
NGKYEVIEITDPDCPYCRKMHEYWGRRPDVTRYVFFLPLAMHPDAEKKIRYILSAENKEL
AFWEVYSGELDNKREILDAPRDDKGLLAAHKAIVAKLGVNSTPTFWVQGTYVNGANTQLI
EKVIGTCKTAEGMAPGAPVKCEDEGQKK
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaacgactgatcaactcctgtctggtcggggcgctggttgccgtactggcagca
ggctcagccctcgcttccccgaaggagggggccaaagaggagagccccgaagcgacgatc
aaggcgctcttcccaacgctgcctctgacaagcgttaagaaaaccccaatcgacggcctc
ttcgaggtgattaccgacggcaacgtcatctacatctatccgaagaccggcaacgtcatc
atcggcaatctcttcaccaaggagggcaagaacctgacggcagaggcgagcaaccgcctg
gtagcggatcgctacaagctcatcaccgccgccgacaaggagaaagcggtgaaagtcggc
aacggcaagtacgaggtcatcgagatcaccgaccccgattgcccctattgccgcaagatg
cacgagtactggggccgcaggcccgacgtgacccgttacgtcttcttccttccccttgcc
atgcatcccgatgccgagaagaagatccgctacatcctgtccgccgagaacaaggaactg
gccttctgggaagtctattcgggcgagttggacaacaagcgtgagatccttgacgccccc
cgggacgacaaggggcttctcgccgcccacaaggcgatcgtggccaagctgggcgtgaac
tctactcccaccttctgggtgcagggaacctatgtgaacggcgccaatacccagctcatc
gagaaggtgatcggcacgtgcaagaccgccgagggcatggctcccggtgctcctgtcaag
tgcgaggacgaggggcagaagaaatag

DBGET integrated database retrieval system