KEGG   Geobacter sulfurreducens PCA: GSU0859Help
Entry
GSU0859           CDS       T00155                                 

Gene name
galU
Definition
glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
gsu  Geobacter sulfurreducens PCA
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:gsu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    GSU0859 (galU)
   00052 Galactose metabolism
    GSU0859 (galU)
   00500 Starch and sucrose metabolism
    GSU0859 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    GSU0859 (galU)
Enzymes [BR:gsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     GSU0859 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(918500..919369)
Genome map
AA seq 289 aa AA seqDB search
MQVKKAVFPVAGLGTRFLPATKSSPKEMLPLIDKPLVQYVVEEAVASGIEQLLFVTGRSK
RAIEDHFDISFELEALLQEKGKDDMLQEVREIADMVKIFYVRQKQALGLGHAILCAREFV
GDEPFAVLLGDDIIDAEQPCLGQLLDVYRKYRGPVVALEKVPIEAISSYGCVKATGITDR
IFEVTDLVEKPRREEAPSDMAIIGRYVLTPDIFPILERQTPGKGGEIQLTDALLTLSREE
AIYGCLFKGKRHDCGDKLGFLKATVDMALKREEFNEEFRDYLREVLARG
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtaaaaaaagcggtattcccggtggcgggactcggtacccggtttcttccggca
accaaatcatctcccaaggagatgctccccctgatcgacaagccgctggtccaatacgtg
gtggaggaggcggttgcctcgggcatcgagcagctcctctttgtgaccggtcggagcaag
cgggccattgaggatcacttcgacatctccttcgagctggaagcgctgctccaggaaaag
gggaaggatgacatgctccaggaggtgcgggagattgccgacatggtgaagattttctat
gtccggcagaaacaggccctgggactcggccacgccatcctctgcgccagggaattcgtg
ggcgacgaacccttcgcggtcctgctgggggacgacatcatcgacgcggaacaaccctgc
ctgggccagctcctggatgtctaccgtaaataccggggtccggtcgtggccctggaaaag
gtgcccatcgaggccatctcctcctacggctgcgtgaaggcaacgggaataaccgaccgg
atcttcgaggtgactgacctggtggaaaaacctcgccgcgaggaggccccttcggacatg
gccatcatcggtcgttacgtccttacccccgacatctttcccatcctggaacgccagacc
cccggcaaggggggtgaaatccagctcaccgacgccctgctcaccctgtcgcgggaagag
gccatttacggctgcctgttcaagggaaagcgccacgactgcggcgacaagctcggcttc
ctgaaagccacggtggacatggccctcaaacgggaggagttcaacgaagagttccgggac
tatctgcgggaagtgctggccaggggctga

DBGET integrated database retrieval system