KEGG   Geobacter sulfurreducens PCA: GSU1076Help
Entry
GSU1076           CDS       T00155                                 

Gene name
ruvA
Definition
(RefSeq) Holliday junction DNA helicase RuvA
  KO
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
gsu  Geobacter sulfurreducens PCA
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:gsu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    GSU1076 (ruvA)
Enzymes [BR:gsu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     GSU1076 (ruvA)
DNA repair and recombination proteins [BR:gsu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     GSU1076 (ruvA)
    RecFOR pathway proteins
     GSU1076 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1164432..1165031
Genome map
AA seq 199 aa AA seqDB search
MIALLTGRLAHKSPDAIIIDVNGVGYRVQIPFSTYYELPEEGKTVSLSIHTHVKEDSISL
FGFRTLAEKEFFQLLISVSGIGPKMARDILSNIQPEELAAAIVQGNLVRLSSIPGIGKKT
AERLVLELKEKVRKMDVAPSAQEAPSSEAPAEVADDVASALVNLGYKEAVVRKVLAEMSI
EPDASTEAVLRQALKVLMK
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcccttctcaccggcaggctcgcccataaatcccccgatgccatcattatcgat
gtgaacggtgtcggctaccgggtccagattcctttctcaacctactacgagcttcccgag
gaggggaagacagtttccctttcgatacatacccatgtgaaggaagactccattagcctc
ttcggcttccgaacccttgccgagaaggagttctttcagctgctcatctcggtttccggc
atcggccccaagatggcccgcgacatcctgtccaacatccagccggaggaactggccgcc
gccattgtgcaggggaatctcgtgaggctctcatccatacccggcatcggcaaaaagacc
gccgagcggctggtgctggaactcaaggaaaaggtccggaaaatggatgtggcgccgtcg
gcccaggaggcgccctccagcgaagcccccgccgaggtggctgacgacgtggcctcggcc
cttgtgaacctcggctataaggaggcggtggtccggaaggtgttggccgagatgagcatc
gagcccgatgcctccacggaggcggtgcttcggcaggccctcaaggtgttgatgaaatag

DBGET integrated database retrieval system