KEGG   Geobacter sulfurreducens PCA: GSU1076Help
Entry
GSU1076           CDS       T00155                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
gsu  Geobacter sulfurreducens PCA
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:gsu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    GSU1076 (ruvA)
Enzymes [BR:gsu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     GSU1076 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1164432..1165031
Genome map
AA seq 199 aa AA seqDB search
MIALLTGRLAHKSPDAIIIDVNGVGYRVQIPFSTYYELPEEGKTVSLSIHTHVKEDSISL
FGFRTLAEKEFFQLLISVSGIGPKMARDILSNIQPEELAAAIVQGNLVRLSSIPGIGKKT
AERLVLELKEKVRKMDVAPSAQEAPSSEAPAEVADDVASALVNLGYKEAVVRKVLAEMSI
EPDASTEAVLRQALKVLMK
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcccttctcaccggcaggctcgcccataaatcccccgatgccatcattatcgat
gtgaacggtgtcggctaccgggtccagattcctttctcaacctactacgagcttcccgag
gaggggaagacagtttccctttcgatacatacccatgtgaaggaagactccattagcctc
ttcggcttccgaacccttgccgagaaggagttctttcagctgctcatctcggtttccggc
atcggccccaagatggcccgcgacatcctgtccaacatccagccggaggaactggccgcc
gccattgtgcaggggaatctcgtgaggctctcatccatacccggcatcggcaaaaagacc
gccgagcggctggtgctggaactcaaggaaaaggtccggaaaatggatgtggcgccgtcg
gcccaggaggcgccctccagcgaagcccccgccgaggtggctgacgacgtggcctcggcc
cttgtgaacctcggctataaggaggcggtggtccggaaggtgttggccgagatgagcatc
gagcccgatgcctccacggaggcggtgcttcggcaggccctcaaggtgttgatgaaatag

DBGET integrated database retrieval system