KEGG   Geobacter sulfurreducens PCA: GSU1535Help
Entry
GSU1535           CDS       T00155                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
gsu  Geobacter sulfurreducens PCA
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:gsu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    GSU1535 (recD)
Enzymes [BR:gsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     GSU1535 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1687045..1688832
Genome map
AA seq 595 aa AA seqDB search
MSADDLQFRDIDACFADFLCRLAGGRNDDLHRAAMHASAAVGAGHVCLHLDEAFGSNGAA
LAVTLRALPVVGPPGGRTPLILDEKNRLYLYRYWNYEYLVAEFIKQKSAELRPVSLPLLR
AGIDRIFGPKGDDAVDWQRVAAAAAVRSGFCVISGGPGTGKTSTVVSILALLLEQAGEEG
AGIALAAPTGKAAARLGDSIRDARQRLAAVTPVAERIPGQVSTIHRLLGVIPGSVRFRHD
RHNPLPHRVVVVDEASMVPLPLMARLVEALAPSARLILLGDRDQLASVEAGAVLGDICDT
GRAHRFSAPFREFIRDAASEEIEGEAGDDGNDQPGTPADSLVILRRNYRFGAASAIGAAS
AAVNEGDGDRLMALVSGEGMDGGVALRPVPPAERLAGALAESVVAGYGEYLGQADPEQAL
ACFDRFRVLCAVRQGEYGVQGLNRAIERVLARQGLIDADRVWYPGRPVMVTVNDYGLGLF
NGDIGLAVADPAFSGGLAVCFPAPGGGVRKISPARLPAHETVFAMTVHKSQGSEFDRILL
VLPPFDSPVLTRELVYTGLTRARTGAVIWADEEILRSAAARRSERRSGLREALWG
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgccgacgacctgcaattccgcgacatcgacgcctgttttgccgacttcctctgc
cgcctggccgggggccggaacgacgatctccatcgggccgccatgcacgccagcgccgcc
gtaggggccggccacgtctgcctgcacctggacgaggcctttggcagcaatggagcggcc
ctggccgtcaccctcagggccctgccggtggtgggcccgcccggtggccgcacccccctg
atccttgacgaaaagaaccgcctctacctttatcgatactggaactatgaatatctagtt
gctgaattcataaagcaaaaatccgcagagctccgtcccgtttccctgccgctcctgcgg
gcgggtattgaccggatcttcgggccgaagggggacgatgccgtggactggcagcgggtg
gctgccgcggccgcggtgcggagcggcttttgcgtcatctccggggggccgggtaccggc
aagacctccaccgtggtttcgatcctggccctgctcctggagcaggccggcgaggagggg
gcgggcattgccctggcagcgcccacgggaaaggccgcggcgcggctcggcgactccatc
cgcgacgcccgtcagcgcctggcagcggtgacccccgtggcggaacggattcccggccag
gtctccaccatccaccggctgctgggggtgattcccggctcggtccgtttccgtcatgac
cggcacaatccgctgccccaccgggtagtggtggtggacgaggcctccatggtgccgctg
cctctcatggcccggctggtggaggccctggcgccgtcggctcggctcatcctcctgggg
gaccgggaccagctcgcctcggtggaggccggggccgtgctgggcgacatctgcgacacc
gggcgggcgcaccggttctcggccccgttccgggagttcatccgtgatgccgcgagtgag
gagatcgagggagaagccggggacgacgggaacgaccagccgggtacgccggccgactcc
ctggtgatcctgcgcaggaactaccgcttcggtgcggccagcgccattggcgcggccagt
gcggccgtgaacgagggcgacggggaccggctcatggcgcttgtgtcaggagaagggatg
gacggaggcgtggcgctccggcccgtgccgccggcggagcggcttgccggggccctggct
gagagcgttgttgcggggtacggcgagtatctggggcaggcggacccggaacaggccctg
gcctgcttcgaccgcttccgggtcctttgtgccgttcggcagggggagtacggggtgcag
gggctcaaccgggccatcgagcgggtcctggcacggcaggggctcatcgatgccgaccgc
gtctggtatccggggcggccggtcatggtgacggtgaacgactacgggctggggcttttc
aacggcgacatcggcctggcggttgccgatcccgccttcagcggcggcctggccgtctgc
tttcccgcaccaggcggcggagtcagaaagatttccccggcccggctgcccgcccacgaa
acggttttcgccatgacggtccacaagagccaggggtccgagttcgaccggattctgctg
gtgctcccccccttcgacagtcccgtgctcacgcgggaactggtctacacgggactcacc
cgcgcccggaccggtgcggtcatctgggcggacgaggagatcctgcggtccgctgcggcg
cggaggagcgaacggcggtcgggcctgcgggaagcgttgtggggatga

DBGET integrated database retrieval system