KEGG   Geobacter sulfurreducens PCA: GSU1612Help
Entry
GSU1612           CDS       T00155                                 

Gene name
gpmA
Definition
phosphoglyceromutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
gsu  Geobacter sulfurreducens PCA
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:gsu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GSU1612 (gpmA)
   01230 Biosynthesis of amino acids
    GSU1612 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GSU1612 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    GSU1612 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GSU1612 (gpmA)
Enzymes [BR:gsu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     GSU1612 (gpmA)
Exosome [BR:gsu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   GSU1612 (gpmA)
  Exosomal proteins of melanoma cells
   GSU1612 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1766002..1766745
Genome map
AA seq 247 aa AA seqDB search
MRTLVLIRHGESVWNRENRFTGWTDVGLTDKGAAEALRAGRTLKNEGFAFDEAFTSVLKR
AIKTLWIVLEEMDQMWIPEHRHWRLNERHYGALQGLNKAETAERHGMEQVHVWRRSYDIP
PPPLAAGDPRNPARDPRYAELDPADIPLTESLKDTVARFLPYWHETIAPRILAGRRLLIA
AHGNSLRALVKYLDGIGDDAIAGLNIPTGIPLVYELEDDLHPIRSYYLGDPDEVARATQS
VADQVKR
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgagaacgctcgttctgattcgtcatggggagagtgtctggaacagggaaaaccgtttt
accggctggactgacgtggggctgaccgataagggcgcggcagaggccctgcgtgccggt
cgtaccctgaaaaacgaggggtttgcctttgacgaggcgttcacctcagtgctcaagcgg
gccatcaaaaccctctggatcgttttggaggagatggatcagatgtggattccggagcac
cgtcactggcggcttaatgaacgccactacggcgcgctccagggactcaataaggccgaa
actgccgaaaggcacggcatggaacaagttcatgtctggcgccgcagctatgatattccg
ccaccgcccctggccgccggcgatccgcgcaaccctgcacgggacccgcgctatgcggag
cttgatcccgcagatatccccctgaccgagtcgctcaaggataccgtagcccgtttcctt
ccctactggcacgagacgattgcgccccgcattctcgcgggccgccgcctgctcatcgcc
gcccatggcaacagtctgcgggccctggtgaagtacctggacggcatcggggacgacgcc
attgccggtctgaatattcccaccggcattccccttgtctatgagctggaagatgacctg
caccccatacgaagctattacctgggtgatcctgacgaggttgcccgggccacccagtcg
gtggcggatcaggtaaagaggtag

DBGET integrated database retrieval system