KEGG   Geobacter sulfurreducens PCA: GSU1695Help
Entry
GSU1695           CDS       T00155                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
gsu  Geobacter sulfurreducens PCA
Pathway
gsu00260  Glycine, serine and threonine metabolism
gsu00750  Vitamin B6 metabolism
gsu01100  Metabolic pathways
gsu01110  Biosynthesis of secondary metabolites
gsu01120  Microbial metabolism in diverse environments
gsu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gsu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GSU1695 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    GSU1695 (thrC)
Enzymes [BR:gsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     GSU1695 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-GeneID: 2685570
NCBI-ProteinID: NP_952746
UniProt: Q74CH8
Position
complement(1853250..1854635)
Genome map
AA seq 461 aa AA seqDB search
MRYISTRGTIQPIRFKDAVMMGLATDGGLLLPETIPAIDRDTLAAWKTLPFQELAFRIIS
RYADDIPADDLRSLIERSYATFDHPDVTPVVERGGLHILELFHGPTLAFKDVALQFLGNL
FEYLLQERNERMNIVGATSGDTGSAAIYGVRGKENINIFILHPHGKTSPVQALQMTTVLD
PNVHNIAVRGTFDDCQNIVKSLFNDLPFKERYALGAVNSINWARVLAQVVYYFLSYFRVA
KTIGDEVVFSVPTGNFGDIFAGYVAKRMGLPIARLLLATNENNILARFINDGDYSLSAVV
PTVSPSMDIQLASNFERYVYYLFGEDPARVREAFATLPARGRIVFSDAEMEHVRTEFLAC
SVNQQETVDTIASFNRETGYLLDPHTAVGVRAARQLVTDGTPVICLATAHPAKFADAVVR
AVGFEPPRPPSLMGIEDLPSRCEVLDARIEQIRTFIEEKAR
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgcgctacatcagcaccagaggaaccattcagcccattcgcttcaaggacgcggtcatg
atggggctcgccaccgatggggggcttcttctgccggaaacaataccggccatcgaccgg
gacacgctcgcggcatggaagacgttgccgttccaggaactcgccttccggatcatctcc
cgctacgccgacgacatcccggccgatgacctgcggagtctcattgagcgctcctatgca
acctttgatcatcccgacgtgacgccggtcgtggagcggggcggcctccacatcctcgaa
ctcttccacggacccacgcttgcattcaaggacgtggctcttcagttcctgggcaacctc
ttcgaatatctgctgcaggagcggaacgaacggatgaacatcgtcggcgccacgtccggc
gacacgggaagtgccgccatttacggcgtgcgggggaaggagaacatcaacatcttcatc
ctccatccccacggcaaaacctcgccggtccaggcgctacagatgaccacggtactcgat
cccaacgtgcacaacattgccgtgcgcggcacctttgacgattgccagaacatcgtcaag
agcctgttcaacgacctccccttcaaggaacgctacgctctcggcgccgtcaactccatc
aactgggcccgggtactggcccaggtggtctattacttcctctcttacttccgcgtggca
aagaccattggcgacgaagttgtcttctcggttcccacgggcaacttcggcgatattttt
gccggctacgtggccaagcgaatgggactgcccattgccagactgctcctggccaccaac
gaaaacaacattctcgcccgcttcatcaatgacggagactattcgctgagtgccgtggtg
cccactgtgtcgccgtccatggacatccagctggcttcaaacttcgaacgctatgtctac
tatctcttcggagaagaccctgccagggtccgcgaggcattcgccacgcttcccgcccgg
ggccggatcgtcttctccgatgccgaaatggagcacgtgcgcaccgaattccttgcctgt
tcggttaaccagcaggagaccgtcgacaccatcgcctccttcaaccgtgaaaccggctac
ctccttgatccccacacggcagtgggtgtccgggctgcccggcaactggtgaccgacggc
acgccggtcatctgccttgccactgctcacccggcgaagttcgccgatgccgtggtgcgc
gcagtagggttcgaaccgccgcgtcctccatcgctcatgggaattgaagacctgccgagc
cggtgcgaggtgcttgacgcacgtatcgagcagatcaggaccttcatcgaggagaaggcc
cgctaa

DBGET integrated database retrieval system