KEGG   Geobacter sulfurreducens PCA: GSU1695Help
Entry
GSU1695           CDS       T00155                                 

Gene name
thrC
Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
gsu  Geobacter sulfurreducens PCA
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gsu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GSU1695 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GSU1695 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    GSU1695 (thrC)
Enzymes [BR:gsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     GSU1695 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1853250..1854635)
Genome map
AA seq 461 aa AA seqDB search
MRYISTRGTIQPIRFKDAVMMGLATDGGLLLPETIPAIDRDTLAAWKTLPFQELAFRIIS
RYADDIPADDLRSLIERSYATFDHPDVTPVVERGGLHILELFHGPTLAFKDVALQFLGNL
FEYLLQERNERMNIVGATSGDTGSAAIYGVRGKENINIFILHPHGKTSPVQALQMTTVLD
PNVHNIAVRGTFDDCQNIVKSLFNDLPFKERYALGAVNSINWARVLAQVVYYFLSYFRVA
KTIGDEVVFSVPTGNFGDIFAGYVAKRMGLPIARLLLATNENNILARFINDGDYSLSAVV
PTVSPSMDIQLASNFERYVYYLFGEDPARVREAFATLPARGRIVFSDAEMEHVRTEFLAC
SVNQQETVDTIASFNRETGYLLDPHTAVGVRAARQLVTDGTPVICLATAHPAKFADAVVR
AVGFEPPRPPSLMGIEDLPSRCEVLDARIEQIRTFIEEKAR
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgcgctacatcagcaccagaggaaccattcagcccattcgcttcaaggacgcggtcatg
atggggctcgccaccgatggggggcttcttctgccggaaacaataccggccatcgaccgg
gacacgctcgcggcatggaagacgttgccgttccaggaactcgccttccggatcatctcc
cgctacgccgacgacatcccggccgatgacctgcggagtctcattgagcgctcctatgca
acctttgatcatcccgacgtgacgccggtcgtggagcggggcggcctccacatcctcgaa
ctcttccacggacccacgcttgcattcaaggacgtggctcttcagttcctgggcaacctc
ttcgaatatctgctgcaggagcggaacgaacggatgaacatcgtcggcgccacgtccggc
gacacgggaagtgccgccatttacggcgtgcgggggaaggagaacatcaacatcttcatc
ctccatccccacggcaaaacctcgccggtccaggcgctacagatgaccacggtactcgat
cccaacgtgcacaacattgccgtgcgcggcacctttgacgattgccagaacatcgtcaag
agcctgttcaacgacctccccttcaaggaacgctacgctctcggcgccgtcaactccatc
aactgggcccgggtactggcccaggtggtctattacttcctctcttacttccgcgtggca
aagaccattggcgacgaagttgtcttctcggttcccacgggcaacttcggcgatattttt
gccggctacgtggccaagcgaatgggactgcccattgccagactgctcctggccaccaac
gaaaacaacattctcgcccgcttcatcaatgacggagactattcgctgagtgccgtggtg
cccactgtgtcgccgtccatggacatccagctggcttcaaacttcgaacgctatgtctac
tatctcttcggagaagaccctgccagggtccgcgaggcattcgccacgcttcccgcccgg
ggccggatcgtcttctccgatgccgaaatggagcacgtgcgcaccgaattccttgcctgt
tcggttaaccagcaggagaccgtcgacaccatcgcctccttcaaccgtgaaaccggctac
ctccttgatccccacacggcagtgggtgtccgggctgcccggcaactggtgaccgacggc
acgccggtcatctgccttgccactgctcacccggcgaagttcgccgatgccgtggtgcgc
gcagtagggttcgaaccgccgcgtcctccatcgctcatgggaattgaagacctgccgagc
cggtgcgaggtgcttgacgcacgtatcgagcagatcaggaccttcatcgaggagaaggcc
cgctaa

DBGET integrated database retrieval system