KEGG   Geobacter sulfurreducens PCA: GSU1702Help
Entry
GSU1702           CDS       T00155                                 

Definition
ROK domain transcriptional regulator/sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
gsu  Geobacter sulfurreducens PCA
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gsu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GSU1702
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GSU1702
   00052 Galactose metabolism
    GSU1702
   00500 Starch and sucrose metabolism
    GSU1702
   00520 Amino sugar and nucleotide sugar metabolism
    GSU1702
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    GSU1702
   00524 Butirosin and neomycin biosynthesis
    GSU1702
Enzymes [BR:gsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     GSU1702
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1864391..1865347
Genome map
AA seq 318 aa AA seqDB search
MIRPAFIGMDIGGTNLRMGLVDEAGTILFRFRQKTDIHEGRAAFYEKLAEGIGILKEHAE
QAGFRIVAVGAGVPGLVANDGHIHVSVNLPAIDSINLRHDLERISGLPATVANDVNATAY
GEKSFGAGREFDSFLMVTLGTGVGGGLILNGRLWTGIDGVAGEFGHVTVEPQGTSCPCGN
RGCLEQYASATAIASAAREAMMTGRYVPADGSAIPLTTQDLARLAREGDGAAATFFAEAG
RYLGMATASLANVLNLEALIVGGGVAASFDLIRSSIEREVRARAFPIPAQRLVVVRGALG
DDGGLLGSAALARDEFDI
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgatccgcccggcgttcatcggcatggatatcggtgggaccaatctgcggatgggactc
gtcgacgaggcgggaacgatccttttccgcttcaggcagaaaaccgatattcatgagggg
agagccgccttttacgaaaagctcgccgaggggataggcattctcaaagagcacgcagag
caggcgggattccgcatcgtggcagttggtgccggcgttccggggcttgtggcaaatgac
ggacatatccacgtatcggtgaatcttccggccattgacagcatcaacctccgccatgac
ctggaacgcatcagtggtctgccggcgacggtggccaacgatgtcaacgccaccgcgtac
ggcgagaaatccttcggtgccggacgcgagttcgactcgttcctgatggttacactcggc
accggcgtcggaggagggctcatcctgaacgggcggctgtggaccggaatcgacggcgta
gccggcgagttcggtcatgtgacggtcgagccccaggggacgtcctgtccctgcggcaac
cggggttgtcttgagcaatatgcctctgccacggccatagcctcagccgcgcgagaggcc
atgatgacggggcgatacgtaccggctgacgggtctgcgatacctctcactacccaggat
ctggcccgtctcgcccgggaaggggatggtgcggcggcgacatttttcgccgaggcggga
cgttatctgggcatggcaacggcatcactggccaacgtactcaatctggaagcactgatc
gttggtgggggcgtcgctgcaagctttgatctgatcaggagttccatagagcgagaggtt
cgtgcccgagctttcccgattccggcccagcggctggtggtggtccgtggcgcattgggc
gacgacggaggactcctgggaagcgctgcgctggcccgtgatgagttcgacatctaa

DBGET integrated database retrieval system