KEGG   Geobacter sulfurreducens PCA: GSU1703Help
Entry
GSU1703           CDS       T00155                                 

Gene name
pfk-1
Definition
(RefSeq) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
gsu  Geobacter sulfurreducens PCA
Pathway
gsu00010  Glycolysis / Gluconeogenesis
gsu00030  Pentose phosphate pathway
gsu00051  Fructose and mannose metabolism
gsu00052  Galactose metabolism
gsu00680  Methane metabolism
gsu01100  Metabolic pathways
gsu01110  Biosynthesis of secondary metabolites
gsu01120  Microbial metabolism in diverse environments
gsu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:gsu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GSU1703 (pfk-1)
   00030 Pentose phosphate pathway
    GSU1703 (pfk-1)
   00051 Fructose and mannose metabolism
    GSU1703 (pfk-1)
   00052 Galactose metabolism
    GSU1703 (pfk-1)
  Energy metabolism
   00680 Methane metabolism
    GSU1703 (pfk-1)
Enzymes [BR:gsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     GSU1703 (pfk-1)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     GSU1703 (pfk-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat UPF0261 Fve Peripla_BP_1
Motif
Other DBs
NCBI-GeneID: 2687107
NCBI-ProteinID: NP_952754
UniProt: Q74CH0
Position
1865393..1866484
Genome map
AA seq 363 aa AA seqDB search
MARKVGILTGGGDCPGLNAVIRGVVKSSIIRRGWEVVGIRDGFDGLLYNNRIVPLGLNEV
RGILPRGGTILGTSNRGNPFSYPVEADGKTVLTDVSDEVVANIKKQGIDALVAVGGDGSL
KIALELMNKGIPVVGVPKTIDNDLMETDVTFGYNTALETATDALDKLHSTAESHHRVMIM
EVMGRYAGWIALESGISGGADVILIPEIPYDISAVCRAVDERRRRGSSFSIIVVAEGAFP
RGGNRVVQKRADETNTIERLGGIGQYVARQLGDCLDMDVRVMVLGHLQRGGSPSTFDRCL
GSRFGVAAIDLIEQEQYGRMVCLRGRDIKSVSIERAVRKLKLVNPGGQMVTAAEELGIVV
GRR
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgtaaagtaggcatactgaccggggggggagactgcccgggactcaatgcggtg
atcaggggagttgtcaaaagctccatcatccggcgcggctgggaagtggtcggcatcagg
gacgggttcgacggcctgctctacaacaacagaatcgtaccgctcggtctcaatgaagta
cgtggaatactcccccgcggcggaaccatcctcggtacgtccaatcgcggcaatcccttc
tcataccctgttgaagcggatggcaaaaccgttttaaccgatgtgtccgacgaggtcgtc
gcgaacatcaaaaaacagggaatcgacgcgctcgtggcagtgggaggggacggctcgctc
aagatcgcgcttgagctcatgaacaaggggattcccgttgtgggcgtgccgaagaccatt
gacaacgatctgatggagaccgatgtcacctttggctacaacaccgccctggaaaccgca
accgatgccctggacaagcttcactccacggccgagagtcaccaccgggtcatgatcatg
gaggtcatggggcgctatgccggttggatcgctctcgaatcgggcatcagcggcggtgcg
gacgtcattctcatccccgagattccctacgatatcagtgccgtctgccgcgcggtcgac
gagcggcgaagacggggaagctccttcagtatcatcgtggtggcggagggggcgttcccg
cgcggcggcaaccgggtcgtgcagaagcgggccgatgaaacgaacaccatcgagcggctt
ggggggatcggtcaatacgtggcccggcagctgggagactgcctcgacatggatgttcgc
gtcatggtcctgggccaccttcaacggggcggttcaccatcgacctttgaccgttgccta
ggcagccgcttcggcgttgccgcaatagacctcattgaacaggaacagtatggacgcatg
gtctgtctgcgcggccgcgacatcaaatcggtatccatcgagcgggcggtgcggaagctg
aaactggtgaaccccggcggtcagatggtgacggcggcggaagagctcggcatcgtggtg
gggcggcggtga

DBGET integrated database retrieval system