KEGG   Geobacter sulfurreducens PCA: GSU1703Help
Entry
GSU1703           CDS       T00155                                 

Gene name
pfk-1
Definition
(RefSeq) 6-phosphofructokinase
  KO
K21071  
ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
gsu  Geobacter sulfurreducens PCA
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:gsu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GSU1703 (pfk-1)
   00030 Pentose phosphate pathway
    GSU1703 (pfk-1)
   00051 Fructose and mannose metabolism
    GSU1703 (pfk-1)
   00052 Galactose metabolism
    GSU1703 (pfk-1)
  Energy metabolism
   00680 Methane metabolism
    GSU1703 (pfk-1)
Enzymes [BR:gsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     GSU1703 (pfk-1)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     GSU1703 (pfk-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
1865393..1866484
Genome map
AA seq 363 aa AA seqDB search
MARKVGILTGGGDCPGLNAVIRGVVKSSIIRRGWEVVGIRDGFDGLLYNNRIVPLGLNEV
RGILPRGGTILGTSNRGNPFSYPVEADGKTVLTDVSDEVVANIKKQGIDALVAVGGDGSL
KIALELMNKGIPVVGVPKTIDNDLMETDVTFGYNTALETATDALDKLHSTAESHHRVMIM
EVMGRYAGWIALESGISGGADVILIPEIPYDISAVCRAVDERRRRGSSFSIIVVAEGAFP
RGGNRVVQKRADETNTIERLGGIGQYVARQLGDCLDMDVRVMVLGHLQRGGSPSTFDRCL
GSRFGVAAIDLIEQEQYGRMVCLRGRDIKSVSIERAVRKLKLVNPGGQMVTAAEELGIVV
GRR
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgtaaagtaggcatactgaccggggggggagactgcccgggactcaatgcggtg
atcaggggagttgtcaaaagctccatcatccggcgcggctgggaagtggtcggcatcagg
gacgggttcgacggcctgctctacaacaacagaatcgtaccgctcggtctcaatgaagta
cgtggaatactcccccgcggcggaaccatcctcggtacgtccaatcgcggcaatcccttc
tcataccctgttgaagcggatggcaaaaccgttttaaccgatgtgtccgacgaggtcgtc
gcgaacatcaaaaaacagggaatcgacgcgctcgtggcagtgggaggggacggctcgctc
aagatcgcgcttgagctcatgaacaaggggattcccgttgtgggcgtgccgaagaccatt
gacaacgatctgatggagaccgatgtcacctttggctacaacaccgccctggaaaccgca
accgatgccctggacaagcttcactccacggccgagagtcaccaccgggtcatgatcatg
gaggtcatggggcgctatgccggttggatcgctctcgaatcgggcatcagcggcggtgcg
gacgtcattctcatccccgagattccctacgatatcagtgccgtctgccgcgcggtcgac
gagcggcgaagacggggaagctccttcagtatcatcgtggtggcggagggggcgttcccg
cgcggcggcaaccgggtcgtgcagaagcgggccgatgaaacgaacaccatcgagcggctt
ggggggatcggtcaatacgtggcccggcagctgggagactgcctcgacatggatgttcgc
gtcatggtcctgggccaccttcaacggggcggttcaccatcgacctttgaccgttgccta
ggcagccgcttcggcgttgccgcaatagacctcattgaacaggaacagtatggacgcatg
gtctgtctgcgcggccgcgacatcaaatcggtatccatcgagcgggcggtgcggaagctg
aaactggtgaaccccggcggtcagatggtgacggcggcggaagagctcggcatcgtggtg
gggcggcggtga

DBGET integrated database retrieval system