KEGG   Geobacter sulfurreducens PCA: GSU2068Help
Entry
GSU2068           CDS       T00155                                 

Gene name
pfk-2
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
gsu  Geobacter sulfurreducens PCA
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gsu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GSU2068 (pfk-2)
   01230 Biosynthesis of amino acids
    GSU2068 (pfk-2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GSU2068 (pfk-2)
   00030 Pentose phosphate pathway
    GSU2068 (pfk-2)
   00051 Fructose and mannose metabolism
    GSU2068 (pfk-2)
   00052 Galactose metabolism
    GSU2068 (pfk-2)
  Energy metabolism
   00680 Methane metabolism
    GSU2068 (pfk-2)
Enzymes [BR:gsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     GSU2068 (pfk-2)
Protein phosphatases and associated proteins [BR:gsu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     GSU2068 (pfk-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2270290..2271249
Genome map
AA seq 319 aa AA seqDB search
MKKIGILTSGGDCSGMNAAIRAAVRTAIRMNIEVVGFRKGYLGLMKGDAIPLDTKAVSGI
LHRGGTFLQSARSPEFKTPEGQRTALNNLKALGVEGMVVMGGDGSLTGALALNRLGLPVV
GIPASIDNDIPFTDMALGVDTALNNIIYAVDCIKDTASSHARAFVIEVMGRHSGYLASIS
AIATGAEYALVPEREYDLAEICQQLRARYEEGRDNAIIILAEGAGHGHEIANSIKDAIGF
ETRVTVLGHYQRGGAPTVFDRLLASRLGKKSVELLVTGTWGVMVGLSCNAILATPLEDVI
KGEKRPQDEVLRLAEVLGV
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatcggcatactcaccagcggcggcgactgctcgggcatgaacgccgctatc
cgggccgcggtgcgcacggctatccgcatgaatatcgaagtggtcggtttccgcaagggc
taccttgggctcatgaagggggatgccatccccctggacaccaaggcggtctcgggcatt
ctccaccgggggggcacctttctccagtcggctcgctcccccgagttcaaaacaccggaa
ggacagcgcacggccctgaacaacctgaaggccctcggcgtcgagggaatggttgtaatg
ggcggcgacgggtcgctcaccggtgccctggccttgaaccgtctgggattgccggtggta
ggcattcccgccagcatcgacaacgacatcccgttcaccgatatggcactgggggttgac
acggccctcaacaacatcatctacgccgttgactgtatcaaggacacggccagctctcac
gcgcgggcctttgtcatcgaggttatggggcgccattcgggctaccttgccagcatctcc
gccatcgccaccggcgccgagtacgcactggtccccgaacgggaatacgatctggccgag
atctgtcagcagttgcgggcacgctacgaggaagggcgcgacaatgccatcatcattctg
gcggagggggccggtcatggccatgaaatcgccaacagcatcaaggacgccatcggcttc
gagacgcgggtgacggtgctgggtcactaccagcgcggaggcgcgccgacggtatttgac
cggctgttggcgagccgcttgggaaagaaatcagttgagctgctggtgacaggcacgtgg
ggagtgatggtgggactgtcctgcaatgcaatcctcgccacccccctggaggatgtcatc
aagggtgagaagcgtcctcaggacgaggtgctgcgcttggccgaggtgctgggcgtatga

DBGET integrated database retrieval system