KEGG   Geobacter sulfurreducens PCA: GSU2082Help
Entry
GSU2082           CDS       T00155                                 

Definition
nucleoside diphosphate-sugar dehydratase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
gsu  Geobacter sulfurreducens PCA
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:gsu00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:gsu00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(2288630..2289118)
Genome map
AA seq 162 aa AA seqDB search
MSVSPEFTRGKIHDVVVKPLGKFLDERGWLAELFRSDETDPATMPVMAYVSMTRPGIARG
PHEHVDQTDWFCFIGPSNFKVYLWDSRPDSPTHGVKQTLFAGIDAPMSVIVPPGVVHAYK
NVGGVDGIVFNAPNRLYAGEGKSSPVDEIRHEDVAGSPFILD
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgagcgttagtcccgagttcacccgcggcaagatccacgacgtggtggtgaagcccctt
ggcaagttcctggacgagcggggctggctcgccgaactgttccgcagcgacgaaaccgat
cccgcgaccatgccggtcatggcctacgtttccatgacccggccgggcattgcccggggg
cctcacgagcacgtggaccagaccgactggttttgctttatcggtccgtccaatttcaaa
gtctatctctgggactcccggcccgactcgccgacccacggcgtgaagcagaccctgttc
gcggggatcgacgcgccaatgtccgttatcgtgccgccgggcgtcgtccatgcctacaag
aatgtcggcggtgttgacggcattgtcttcaacgcgcccaacaggctgtatgccggagag
ggaaaatcctcaccggtagatgagatccgccacgaggacgtggccgggtcccccttcatc
ctggattga

DBGET integrated database retrieval system