KEGG   Geobacter sulfurreducens PCA: GSU2196Help
Entry
GSU2196           CDS       T00155                                 

Definition
(RefSeq) M42 family aminopeptidase
Organism
gsu  Geobacter sulfurreducens PCA
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(2408907..2409971)
Genome map
AA seq 354 aa AA seqDB search
MRPESLEFFKKLVEAPSPSGYEQPAQRVFRDYIAPFAEVKTDVMGNVIGLIRGGGENLPR
VMVVGHSDEIGFQVKYIDDNGFIYFAPIGGVDAHLTPGKRVRIHTAKGEVAGVIGKKPIH
LMDEEDRRKVVRLDAQYIDIGATDKKEALEYVRVGDPVTFAAGFERLLGDRVACRAFDDK
AGSFVVAEVLRAVAESGVKLPVDLYGVSSVQEEIGLRGGATSAYSVNPHVGICVEVDFAT
DQPDVEKKHNGEVKLGKGPILPRGANINPPLFDLLSSTAEREEIAVQYTGIPRASGTDAN
VMQISRGGVATALVKLPLRYMHTPVEVISLSDLDQAVRLIVAALPGMAGDFTPR
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgcgtccggaatctctggaatttttcaaaaaacttgtggaggcccccagcccttccggc
tacgagcagccggcccaacgggtgtttcgcgactacatagcccccttcgcggaggtgaag
accgatgtcatgggcaacgtgatcggtctcattcgcggcgggggggagaacctgccgcgg
gtgatggtggtcggccactcggatgagataggctttcaggtcaagtacatcgacgacaac
ggcttcatctattttgcgccgatcggcggggtggacgcccacctgacgccggggaagcgg
gttcgcatccacacggccaagggcgaggtggcaggcgtcatcggcaagaagccgatccat
ttgatggacgaggaagaccggcggaaggtggttcgcctcgacgcccagtacatcgacata
ggcgctaccgacaagaaggaggccctggagtacgtgcgtgtgggtgacccggtcaccttt
gccgccggcttcgaacgcctgctgggcgatcgggttgcctgccgggcgttcgacgacaag
gccggcagcttcgtggtggccgaggtgctccgggccgtggccgaatcgggggtgaaactg
ccggttgatctgtacggcgtctcctcggtacaggaagagatcgggctgcgcggcggcgca
accagcgcctacagcgtcaatccccacgtgggtatctgcgtcgaggtggacttcgccact
gatcagcccgacgtggagaagaagcacaacggcgaggtcaagctcggcaaggggccgatc
ctgccccgtggggccaatatcaatccgcctctctttgatctgctttcctcaacggcggag
cgtgaggagatcgctgtccagtatacgggtatcccccgggcttccggtaccgatgccaac
gtcatgcagatctcccgcggcggcgtcgccaccgccctggtcaagctgccgctccgctac
atgcatacgccggtggaggtgatttccctctccgatcttgatcaggcggtcaggctgatc
gtggcggccttgccggggatggcgggcgacttcactccccgctga

DBGET integrated database retrieval system