KEGG   Geobacter sulfurreducens PCA: GSU2238Help
Entry
GSU2238           CDS       T00155                                 

Gene name
gmk
Definition
(RefSeq) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
gsu  Geobacter sulfurreducens PCA
Pathway
gsu00230  Purine metabolism
gsu01100  Metabolic pathways
Module
gsu_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:gsu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    GSU2238 (gmk)
Enzymes [BR:gsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     GSU2238 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_33 AAA_22 AAA_16 AAA_30 AAA_25 TsaE
Motif
Other DBs
NCBI-GeneID: 2687509
NCBI-ProteinID: NP_953287
UniProt: P60551
Position
complement(2453109..2453720)
Genome map
AA seq 203 aa AA seqDB search
MKREGVLYILSAPSGAGKTTLCREIIDIFPQLRHSVSYTTRTPRPGEIHGKDYFFVSMDE
FHRMIDADEFAEWAEVHGNCYGTSIRTLEENRAAGVDLILDIDIQGARQLQERFAGGVYI
FILPPSFEELRRRLNGRSSDSDEVISRRINAAAGEIRESRWYDYIIVNDQFSRAVEELKS
VIIAEQCRTARVLDAVSEIFSMD
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtgaaggggttttatacatactgtcggcaccgtcgggggcgggtaaaaccacg
ctgtgcagagaaataattgacatttttccacagctgcggcattctgtcagttacactacg
cgcacgccacggcccggcgaaatccatggcaaagactatttttttgtttccatggatgag
tttcaccggatgatcgatgctgatgagttcgcggagtgggcagaggttcacggcaactgc
tacggcacctccatccggacccttgaggagaatcgtgccgcaggcgtggaccttatcctg
gatatcgatatccagggggcacgccagctccaggagcggtttgcgggcggcgtttatatc
tttattctccccccaagctttgaggagttgcgtcgtcggctcaacgggcgctcctcggac
agcgacgaggttatcagccggcggataaacgctgctgccggcgagatccgggaatcccgc
tggtacgactacattatcgtcaacgatcaattcagccgggcggtggaagagctcaaatcg
gtcatcattgccgagcagtgtcgtaccgccagggtgctggatgcggtttcagagattttt
tccatggattga

DBGET integrated database retrieval system