KEGG   Geobacter sulfurreducens PCA: GSU2290Help
Entry
GSU2290           CDS       T00155                                 

Definition
nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
gsu  Geobacter sulfurreducens PCA
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:gsu00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2508301..2508906
Genome map
AA seq 201 aa AA seqDB search
MENDAALLIVDVQNDFCPGGSLAVPEGDTVVPVLNGYISVFRTAGLPIFASRDWHPRMTS
HFKEHGGQWPVHCVQGSHGAQFHPDLALPGNAIVISKGMDPERDDYSAFQGTAADGTPLP
TLLAARGIRHLYLGGLATDYCVKESALEGIRHGLIVTVLTDASRGVDLAPGDSERAVQEM
MRAGVRMTSLEGIRQEQRLRE
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacgatgccgcccttctcatcgtcgacgtccagaatgacttctgcccaggcgga
agtctggccgtccccgagggggacaccgtggttcctgtcctcaacggctatatcagtgtc
ttccgcacagccggactccccatcttcgcctcacgggactggcacccgcggatgacgtcc
catttcaaggaacacggcgggcagtggccggtccattgcgtgcagggaagccacggcgca
cagtttcatccagacctggcacttcccggcaacgctatcgtcatatcgaagggaatggat
ccggaacgggacgactattcggcgttccagggaactgcggccgacgggacgcccctcccg
accctgctcgccgcccgtggcatccgccatctgtacctgggaggacttgccaccgattac
tgcgtgaaggaatcggctctcgaaggaatccggcacggtctcatcgtcactgtgctgacc
gatgcatcacggggagtcgatctcgcccccggcgactcggagcgggcggtgcaggaaatg
atgcgggcgggggtgcggatgacatcccttgagggcatcagacaggaacaacggctgcgg
gagtga

DBGET integrated database retrieval system