KEGG   Geobacter sulfurreducens PCA: GSU2290Help
Entry
GSU2290           CDS       T00155                                 

Definition
nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
gsu  Geobacter sulfurreducens PCA
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gsu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    GSU2290
Enzymes [BR:gsu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     GSU2290
    3.5.1.-  
     GSU2290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2508301..2508906
Genome map
AA seq 201 aa AA seqDB search
MENDAALLIVDVQNDFCPGGSLAVPEGDTVVPVLNGYISVFRTAGLPIFASRDWHPRMTS
HFKEHGGQWPVHCVQGSHGAQFHPDLALPGNAIVISKGMDPERDDYSAFQGTAADGTPLP
TLLAARGIRHLYLGGLATDYCVKESALEGIRHGLIVTVLTDASRGVDLAPGDSERAVQEM
MRAGVRMTSLEGIRQEQRLRE
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacgatgccgcccttctcatcgtcgacgtccagaatgacttctgcccaggcgga
agtctggccgtccccgagggggacaccgtggttcctgtcctcaacggctatatcagtgtc
ttccgcacagccggactccccatcttcgcctcacgggactggcacccgcggatgacgtcc
catttcaaggaacacggcgggcagtggccggtccattgcgtgcagggaagccacggcgca
cagtttcatccagacctggcacttcccggcaacgctatcgtcatatcgaagggaatggat
ccggaacgggacgactattcggcgttccagggaactgcggccgacgggacgcccctcccg
accctgctcgccgcccgtggcatccgccatctgtacctgggaggacttgccaccgattac
tgcgtgaaggaatcggctctcgaaggaatccggcacggtctcatcgtcactgtgctgacc
gatgcatcacggggagtcgatctcgcccccggcgactcggagcgggcggtgcaggaaatg
atgcgggcgggggtgcggatgacatcccttgagggcatcagacaggaacaacggctgcgg
gagtga

DBGET integrated database retrieval system