KEGG   Geobacter sulfurreducens PCA: GSU2371Help
Entry
GSU2371           CDS       T00155                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
gsu  Geobacter sulfurreducens PCA
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:gsu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GSU2371 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GSU2371 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GSU2371 (trpA)
Enzymes [BR:gsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     GSU2371 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2598075..2598869)
Genome map
AA seq 264 aa AA seqDB search
MSRIAGTFAELKHNSRKALVTFITAGDPDLAATEALIPLLAESGADIVELGVPFSDPMAD
GPTIQLSSERALAAGTTLPKILDMVRRVRTRCQVPIVLMGYYNPILIHGLERFAADASAA
GVDGVLLVDLPPEEAAEFKACADRHGLDVIFLLTPTSDEGRIRKVARQARGFVYYVSVTG
VTGARSGVEASVSSNVAAIREAITVPVVVGFGISTPDQAAQVAASADGVVVGSAIVKLFE
RFTAAELGREVATFVSALREAIGN
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgagcagaattgccggcacatttgccgaattgaagcacaacagccgcaaggccctcgtt
accttcatcaccgccggtgacccggacctggccgccacggaagcgctgattccgcttctg
gctgaaagcggcgccgacatcgtggaacttggcgttcccttttcggatccaatggccgac
ggccccaccatccagctttcttccgagcgggcccttgctgcggggacgaccctgccgaag
atcctcgacatggtgcgccgggtccgtacccgctgccaggtgcccatcgtgctcatgggc
tactacaatccgattctgatccacggccttgagcgctttgcggcggatgcctcggccgcg
ggggtcgacggcgtgctcctggttgaccttcccccggaggaggcggccgagttcaaggca
tgtgccgaccgccacgggctcgatgttatcttccttctcacccccacctccgacgaaggg
cgcatccggaaagtggcgcggcaggcccgcgggttcgtctactatgtgtcggtgaccggc
gtgaccggcgcgcggagcggcgtggaggcgtccgtttcctccaacgtggccgccattcgc
gaggcgatcaccgtgccggtcgtggtcggcttcggcatctcgacgcctgaccaggctgcc
caggtggccgcctcggccgacggcgtggtcgtggggagcgccattgtaaaattgttcgag
cgtttcacggccgccgagctcgggcgtgaggtcgcaaccttcgtttccgcgctgcgcgaa
gcgatcggaaattga

DBGET integrated database retrieval system