KEGG   Geobacter sulfurreducens PCA: GSU2371Help
Entry
GSU2371           CDS       T00155                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
gsu  Geobacter sulfurreducens PCA
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:gsu01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:gsu00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:gsu00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(2598075..2598869)
Genome map
AA seq 264 aa AA seqDB search
MSRIAGTFAELKHNSRKALVTFITAGDPDLAATEALIPLLAESGADIVELGVPFSDPMAD
GPTIQLSSERALAAGTTLPKILDMVRRVRTRCQVPIVLMGYYNPILIHGLERFAADASAA
GVDGVLLVDLPPEEAAEFKACADRHGLDVIFLLTPTSDEGRIRKVARQARGFVYYVSVTG
VTGARSGVEASVSSNVAAIREAITVPVVVGFGISTPDQAAQVAASADGVVVGSAIVKLFE
RFTAAELGREVATFVSALREAIGN
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgagcagaattgccggcacatttgccgaattgaagcacaacagccgcaaggccctcgtt
accttcatcaccgccggtgacccggacctggccgccacggaagcgctgattccgcttctg
gctgaaagcggcgccgacatcgtggaacttggcgttcccttttcggatccaatggccgac
ggccccaccatccagctttcttccgagcgggcccttgctgcggggacgaccctgccgaag
atcctcgacatggtgcgccgggtccgtacccgctgccaggtgcccatcgtgctcatgggc
tactacaatccgattctgatccacggccttgagcgctttgcggcggatgcctcggccgcg
ggggtcgacggcgtgctcctggttgaccttcccccggaggaggcggccgagttcaaggca
tgtgccgaccgccacgggctcgatgttatcttccttctcacccccacctccgacgaaggg
cgcatccggaaagtggcgcggcaggcccgcgggttcgtctactatgtgtcggtgaccggc
gtgaccggcgcgcggagcggcgtggaggcgtccgtttcctccaacgtggccgccattcgc
gaggcgatcaccgtgccggtcgtggtcggcttcggcatctcgacgcctgaccaggctgcc
caggtggccgcctcggccgacggcgtggtcgtggggagcgccattgtaaaattgttcgag
cgtttcacggccgccgagctcgggcgtgaggtcgcaaccttcgtttccgcgctgcgcgaa
gcgatcggaaattga

DBGET integrated database retrieval system