KEGG   Geobacter sulfurreducens PCA: GSU2375Help
Entry
GSU2375           CDS       T00155                                 

Gene name
trpB1
Definition
(RefSeq) tryptophan synthase subunit beta
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
gsu  Geobacter sulfurreducens PCA
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:gsu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GSU2375 (trpB1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GSU2375 (trpB1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GSU2375 (trpB1)
Enzymes [BR:gsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     GSU2375 (trpB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2602787..2603977)
Genome map
AA seq 396 aa AA seqDB search
MKLPDKQGHFGQFGGRYVPETLMPALLELEQAYNHYRHDREFKEEFDYYLRQYVGRPNPL
YFAEKLTQKLGGAKIYLKREDLNHTGAHKVNNTIGQGLLAKRMGKKRVIAETGAGQHGVA
TATIAALFGMECEVFMGEEDIRRQALNVFRMKLLGATVTPVTAGTATLKDAMNEALRNWV
TYIHNTFYVIGTVAGPHPYPAMVRDFQTVIGREAKAQHRKIEGRLPDVLVACVGGGSNAL
GLFYPFLDDREVRMVGVEAAGHGIASGAHAAPLCAGSVGVLHGNKTYLLQDEFGQIANAH
SVSAGLDYPGVGPEHAWLKDAGRAEYVSVTDEEALDAFTLLTREEGIMPALESSHAIAHV
VKLAPTLPKEQTIVVCLSGRGDKDIHTVADAMGVRF
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaaattacccgacaaacagggccatttcggccagttcggcggccgctacgtgccggaa
accctcatgccggccctgttggagctggagcaggcctacaaccactaccggcacgaccgc
gagttcaaggaggagttcgactactacctccgccagtacgtggggcggcccaatccgctc
tatttcgccgaaaagctcacgcaaaagctcgggggcgcgaagatttacctcaagcgcgag
gacctgaaccacaccggagcccacaaggtgaacaacaccatcggccaggggcttctggcc
aagcggatggggaagaagcgggtcattgcggagaccggcgcggggcagcacggggtggcc
accgccaccatcgcggcccttttcggcatggagtgcgaagtcttcatgggagaggaggat
atccggcgccaggctctgaacgtcttccggatgaagctcctgggggccacggtcacgccg
gtgaccgccgggaccgccaccctcaaggacgccatgaacgaggccctgcgcaactgggtg
acctacatccacaacaccttctacgtgatcggcaccgtggcggggccccacccctatccg
gccatggtgcgcgacttccagacggtcatcggccgtgaggccaaggcccagcacaggaag
atcgaggggcggctgccggatgtgctggtggcctgcgtcggcggcggcagcaacgccctg
gggctcttctaccccttcctcgatgaccgggaagtgcggatggtgggggtggaggcggcg
ggccacggcatcgcctccggcgcccacgcggcgcccctgtgtgccgggagcgtcggggtc
ctccacggcaacaagacctatctactccaggacgagttcggccagatcgccaatgcccac
tccgtatccgccggacttgactaccccggggtcggcccggagcatgcctggctcaaggat
gcgggccgggccgagtacgtgtcggtcacggatgaggaagccctggacgccttcacgctc
ctgacccgcgaggaggggatcatgccggccctggagtcgtcccacgccatcgcccacgtg
gtgaagctggcaccgacgctgccgaaggagcagaccatcgtggtctgtctttcgggccgg
ggggacaaggatattcataccgtggccgatgccatgggggtacgtttttag

DBGET integrated database retrieval system