KEGG   Geobacter sulfurreducens PCA: GSU2379Help
Entry
GSU2379           CDS       T00155                                 

Gene name
trpB2
Definition
(RefSeq) tryptophan synthase subunit beta
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
gsu  Geobacter sulfurreducens PCA
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:gsu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GSU2379 (trpB2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GSU2379 (trpB2)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GSU2379 (trpB2)
Enzymes [BR:gsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     GSU2379 (trpB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(2607443..2608798)
Genome map
AA seq 451 aa AA seqDB search
MQTKIVLDESRIPTHWYNIIPDMPGPLAPVINPRTLQPVTPDDLLPIFPMAIIEQEISGE
RWIPIPEEVREIYRLWRPSPLYRAHRLEQALGTPAKIYYKYEGVSPAGSHKPNSAIPQAY
YNKQAGIRRLATETGAGQWGSSLALACSMFGLECTVYMVKVSCTQKPYRKSMMQLWGANV
IPSPSEFTNAGRSILAHDPDSNGSLGIAISEAVEDAASRADTNYALGSVLNHVCLHQTII
GQEAREQLALAGDYPDVVIACCGGGSNFAGTAFPFLADRAAGKNVRCLAVEPASCPTLTK
GIYAFDYGDTAKMAPIAMMYTLGHDFMPPGIHAGGLRYHGESPLVSQLHHAGLIEAKSYR
QTACFEAAHLFARHEGIVPAPESSHAVRAAIDEAVIAKEEGKEKTILFCLSGHGQLDMVA
YDAYLSGGLEDVEYPEEMIRESLAKLPKVEL
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgcaaactaaaatagtgctggacgaaagccgcatcccgacccactggtacaacatcatc
cccgacatgcccggccccctggcgccggtcatcaacccccgcacccttcagccggtgacc
cccgacgaccttctccccatcttccccatggccatcatcgagcaggagatttcgggcgaa
cggtggattccgatcccggaagaggtgcgggagatctaccgcctctggcggccgtctccc
ctctaccgtgcccaccggctggagcaggccctcggcaccccggcgaagatctactacaaa
tacgaaggggtgtccccggccggctcacacaagcccaactccgccatcccccaggcgtac
tacaacaagcaggcgggcatccggcggctggccaccgagaccggcgccgggcagtggggg
agttccctggccctggcctgctccatgttcggcctggagtgcacggtctacatggtcaag
gtgtcgtgcacccagaagccgtaccgcaaaagcatgatgcagctctggggggccaacgtg
atcccgtcgccgtccgagttcaccaacgccgggcgctccatcctggcccacgatccggac
agcaacggcagcctcggcatcgccatctccgaggcggttgaggatgccgcctcccgcgcc
gacaccaactatgccctgggcagcgttctgaaccacgtctgcctccaccagaccatcatc
ggccaggaggccagggaacagctggccctggccggcgactaccccgacgtggtcatcgcc
tgctgcggcggcggctccaacttcgccggcacggccttcccgttcctggccgaccgggcc
gccggcaagaacgtccgctgtctggccgtggaacccgcctcgtgcccgaccctgaccaag
gggatctacgccttcgactacggcgacaccgccaagatggcccccatcgccatgatgtac
accctggggcacgacttcatgccgcccggtatccacgccggcgggctgcgctaccacggc
gagtcgcccctggtgtcgcaactccaccatgccggcctcatcgaggccaagtcgtaccgc
cagaccgcctgtttcgaggcagcccacctctttgcccggcacgaggggatcgtgccggcc
cccgaatcgtcccacgcggtgcgggccgccattgacgaagcagtcatcgccaaggaggag
gggaaggaaaagaccattctcttctgcctctcgggccacggccagctggacatggtggcc
tacgacgcctacctctccggcggcctggaagacgtcgaataccccgaggagatgatccgg
gagtccctggccaaactgcccaaggtggaactgtga

DBGET integrated database retrieval system