KEGG   Geobacter sulfurreducens PCA: GSU2380Help
Entry
GSU2380           CDS       T00155                                 

Gene name
trpC
Definition
(RefSeq) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
gsu  Geobacter sulfurreducens PCA
Pathway
gsu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
gsu01100  Metabolic pathways
gsu01110  Biosynthesis of secondary metabolites
gsu01130  Biosynthesis of antibiotics
gsu01230  Biosynthesis of amino acids
Module
gsu_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:gsu00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GSU2380 (trpC)
Enzymes [BR:gsu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     GSU2380 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh
Motif
Other DBs
NCBI-GeneID: 2688040
NCBI-ProteinID: NP_953426
UniProt: Q74AH5
Position
complement(2608846..2609646)
Genome map
AA seq 266 aa AA seqDB search
MTDTPDILKKIVEHKRGEVAAARSAAPLAEVKARIADLEDQPRGFERALRDCHASGWTAV
IAEVKKGSPSKGVIRPDFDPLEIAETYEQNGAACLSVLTDEQFFLGNLRYLALIREQVRL
PLLRKDFLFDPYQVYEARAAGADAILLIAAMLEPAQIEDLAGFAREQYLDVLLEVHDEQE
LETALASSCTLIGINNRNLRTFVTDLGTTERLIPMIPADRFVVTESGINTRDDILRLQAA
GAHGFLIGESLMREEDIGAKLRELLG
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatacccccgatatcctgaagaagatcgtcgagcacaagcggggcgaagtggct
gcggcccggtccgctgccccccttgccgaggtgaaggcccgcatcgcggatctggaggac
cagccccggggcttcgagcgggccctgcgggactgccacgcctccggctggaccgccgtc
atcgccgaggtgaagaaagggtccccctccaagggggtcatccgccccgatttcgatccc
ctggagattgccgagacctacgagcagaacggcgccgcctgcctctctgtcctgaccgac
gagcagttcttcctgggcaacctccgctacctggccctgatccgggaacaggtgcggctg
ccgctgctgcgcaaggatttcctcttcgacccctatcaggtctacgaggctcgcgccgcc
ggggccgacgccatcctcctcatcgcggccatgctggaaccggcgcagatcgaggatctg
gccgggtttgcccgggagcagtacctcgacgtgctgctggaggtccacgacgagcaggag
ctggagacggcccttgcgtcgagctgcaccctgatcgggatcaacaaccgcaacctccgc
accttcgtcaccgacctgggcaccaccgagcggctcatccccatgatccccgccgaccgg
ttcgtggtgaccgagagcggcatcaatacccgtgacgacatcctccgcctccaggctgcc
ggcgcccacggcttcctcatcggcgagtccctcatgcgggaagaggatatcggggcaaaa
ctgcgggagttgctgggatag

DBGET integrated database retrieval system