KEGG   Geobacter sulfurreducens PCA: GSU2415Help
Entry
GSU2415           CDS       T00155                                 

Definition
SGNH-hydrolase lipoprotein, lysophospholipase L1-like subgroup
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
gsu  Geobacter sulfurreducens PCA
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:gsu01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2649478..2650158
Genome map
AA seq 226 aa AA seqDB search
MNLRKSLMAVIALTALAGCDRKEAARPAAPAQQEARATAGTIVAVGDSLTAGYGLDEHDA
YPAQLERLLREAGRPWRVVNAGISGETSSGALSRVNWVLTLKPDIVILVTGANDGLRGID
PKVTEKNLDEMVRTLKERNVTVVLGGMKMVANLGRDYTRAFAAVYPAVAKRHDLILIPFF
LEGVAGRPDLNQADGIHPTAEGYRIVSDTVLPYVIKAIEQTPPSGG
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
gtgaatctcaggaaaagtctgatggcggttattgcgctgaccgccctggccgggtgcgac
cgcaaggaggctgcccggcccgcggctccggcgcagcaggaggcccgtgccacggcaggg
accatcgtggcggtgggggacagcctcaccgccggctacggcctcgacgaacacgatgcc
tacccggcccaactggagcggctgctgcgggaggccggtcgcccctggcgggtggtgaat
gcgggaatcagcggcgagacgagcagcggcgccctgtcgcgcgtgaactgggtcctaacc
ctgaagccggatatcgttatcctggtcaccggcgccaacgacggcctgcgggggatcgac
ccgaaggtgacggaaaagaatctcgacgagatggtccgcacgctgaaggagcgcaacgtc
accgtggtcctgggcgggatgaagatggtcgcgaacctgggccgggactacacccgcgcc
tttgccgccgtctacccggccgtggcgaagcgccacgacctgatcctgattccctttttc
ctggaaggggttgcagggcgccccgacctgaaccaggccgacggcatccaccccacggcc
gagggataccgaatcgtgtccgatacggtacttccctacgtgatcaaggccatcgagcag
actccgccatctggcggctga

DBGET integrated database retrieval system