KEGG   Geobacter sulfurreducens PCA: GSU2448Help
Entry
GSU2448           CDS       T00155                                 

Gene name
sucB
Definition
2-oxoglutarate dehydrogenase, E2 protein, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
gsu  Geobacter sulfurreducens PCA
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:gsu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GSU2448 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GSU2448 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    GSU2448 (sucB)
Enzymes [BR:gsu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     GSU2448 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2684926..2686155)
Genome map
AA seq 409 aa AA seqDB search
MEIKIPSVGESVFEALVATWLRQDGDAVRKDEPVCEIETDKITMELNAEADGVLSIAVPA
GTTVKIGTVIGTIREGAAAPVAESPAPAQAAAAAPAAEPPLSPSVRKMARERGISPEAVP
GTGRGGRVTVDDLFSFAEKREQGASPAGAPPPAAPQPPAQQPRPAAEQPRQAEPPEADRT
TRTPMTPIRKRIAERLMAARQQTAMLTTFNEADLGRIVELRARHKEQFAKRHGVSLGFMS
FFVKACVEALKAFPLVNARIDGNDIVRHHYYNIGIAIGADKGLVVPVLRDADRLHFWEIE
QAIAAFVEKIKTNRLELSDLEGGTFSITNGGVYGSLLSTPILNPPQSGVLGMHAIQDRPV
ARDGQVVIRPMMYLALSYDHRIIDGREAVGFLRTVKEYVEDPEELFLEG
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcaaaataccatcggtgggtgaatcggtattcgaggccctggtggccacgtgg
ctccgccaggacggcgatgcggtccgcaaggacgagccggtctgcgagatcgagaccgac
aagatcaccatggagcttaacgctgaggccgacggggttctctccatcgcggtgccggcc
gggaccacggtgaagatcggcacggtcatcggtaccattcgcgaaggcgctgccgccccc
gttgccgagtcgccggctccggcacaggccgctgccgccgcgcccgccgcagagccccct
ctttccccgtcggtgcgtaaaatggcgcgggagcgggggatcagccccgaggcggtgccc
ggtaccggccggggagggcgggtgacggtggatgatctcttctcctttgccgaaaagcgg
gagcagggggcgtctccggccggggctcctccgccggccgctccccagcctcccgcgcag
cagccccggccggcggcagagcagccccgccaggccgagccgccggaggccgatcgcacc
acccgcacccccatgacccccatccgcaagcggatcgcggaacgtctcatggcggcgcgt
cagcagaccgccatgctcaccaccttcaacgaggccgatctggggcgcattgtggaactg
cgtgcccgccacaaggagcagttcgccaagcggcacggggtatccttggggttcatgtcg
ttcttcgtcaaggcctgcgtagaggccctgaaagcctttcccctggtgaacgcccgcatc
gacggcaacgacatcgtccggcaccactactacaacatcggcatcgccatcggcgcggac
aaggggctggtggtgccggtgctccgggatgcggaccgcctccatttctgggagatcgaa
caggccatcgccgcctttgtcgaaaagatcaaaaccaaccggctcgaactctcggacctg
gaggggggcaccttctccataaccaacggcggggtgtacggctcgctcctttccaccccc
atcctcaatccgccccagagcggggtgctcggcatgcacgccattcaggaccgtcccgtg
gcccgggacgggcaggtggtcatccggcccatgatgtacctggccctgtcctacgaccac
cggatcatcgacggccgcgaagcggtgggattcctgcgcacggtgaaagagtatgtggaa
gatccggaggagctgttccttgaggggtag

DBGET integrated database retrieval system