KEGG   Geobacter sulfurreducens PCA: GSU2656Help
Entry
GSU2656           CDS       T00155                                 

Gene name
bkdF
Definition
branched-chain alpha-keto acid dehydrogenase E2 subunit
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
gsu  Geobacter sulfurreducens PCA
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:gsu01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:gsu00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:gsu00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:gsu00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2927238..2928416
Genome map
AA seq 392 aa AA seqDB search
MPYDFKLPDLGEGITEAELRRWLVKEGDTVAEHQPVVEVETDKAVVEVPSPRAGRVITRA
RLEGETVMVGETLLTIAEEEATPPVRKPSVGIVGELPEAEEAVGTQQPAILATPLVRKLA
RERGIDLATVRGSGPRGSITPEDVAGAGAPARPDAGEFGPAERIPLRGVRRSIARNVMTS
QRNTAFVTGMEEADITELWHLREREQQAVEQRGTHLTFLPFFIKAVQHALREHPYLNAAI
DDVAGEIILKKHYHFGIAVETPDGLMVPVIRNVDAKSIIELASELQELGRKARERTITLD
EMRGSTFTLTNFGHFGGVFATPVINWPDVAILGFGRIADRPWVHAGQIVVRTILPLSLTF
DHRVTDGADAAQFLSKVVRYLEDPALLFIESI
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgccgtatgacttcaagctccccgatctgggcgaagggataaccgaggcggaactgcgc
cgctggctcgtgaaggaaggggataccgtagccgagcaccagccggtggtggaggtggag
accgacaaggcagtggtggaggtcccctcgccccgagccgggagggtgataacgcgtgcc
cggctggaaggggaaaccgtcatggtcggagagacgctcctcaccatcgctgaagaggaa
gcgactccccccgtgcggaaaccctccgtggggatcgtgggcgaactccccgaggcggag
gaagcagtcgggacacagcagccggccatcctcgccacccccctggtcaggaaactggcc
cgggaacggggcatcgacctggcaaccgtgcggggaagcggcccgcgggggagcattacc
cccgaagacgtggcgggcgcgggcgccccggcccggccggatgccggcgagttcgggccg
gcggagcggattcccctgcggggagtgcggcggtccatcgcccggaacgtcatgacctcc
cagcggaacaccgcctttgtcaccggcatggaagaggcggacatcaccgaactgtggcac
ctgcgggaacgggagcagcaggcggtggaacagcggggcacccacctcaccttcctcccc
ttcttcatcaaggccgtccagcacgccctgcgggagcatccctacctgaatgccgccatt
gacgacgtggccggagaaatcatcctcaaaaagcactatcacttcggcattgccgtggag
acccccgacggcctcatggtgccggtaatccgcaacgtggacgccaagagcatcatcgaa
ctggcttcggaactccaggaactgggccgcaaggcccgggagaggaccatcaccctggac
gaaatgcggggcagcaccttcaccctcaccaacttcggccacttcgggggcgtgttcgcc
acccccgtcatcaactggcccgacgtggccatcctcggtttcggccgcattgccgaccgt
ccatgggtccacgccggccagatcgtcgtccgcacgatccttcccctgtccctcaccttc
gaccaccgggttaccgacggagccgacgcggcccagttcctgagcaaggtcgtccgctac
ctggaagatccggcactcctgtttattgaaagcatctga

DBGET integrated database retrieval system