KEGG   Geobacter sulfurreducens PCA: GSU2813Help
Entry
GSU2813           CDS       T00155                                 

Gene name
ccpA
Definition
cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
gsu  Geobacter sulfurreducens PCA
Brite
Enzymes [BR:gsu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     GSU2813 (ccpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
3091629..3092666
Genome map
AA seq 345 aa AA seqDB search
MKQLSVSLAILCAVATSEAFAADELQQRAQGLFKPVPAKAPTLKGNPASPVKVELGKMLY
FDPRLSASHLISCNTCHNVGLGGGDLQATSTGHGWQKGPRNAPTVLNSVFNTAQFWDGRA
KDLAEQAKGPVQASVEMNNTPDQVVKTLNSIPDYVALFKKAFPGEKDPVTFDNMAKAIEV
FEATLITPDSPFDQYLKGKKKALDGKQTAGLKLFLDKGCVACHGGLNLGGTGYFPFGVVE
KPAENILPLGDKGRFAVTNTAKDEYVFRAPSLRNVAITYPYFHSGVVWSLKEAVAVMGSA
QFGIKLSDDESEAIAAFLGSLTGKQPKVVYPIMPASTDATPRPRL
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaattgtccgtgtcgcttgccatcctctgtgcagtcgcaaccagcgaggcattc
gccgccgatgagctgcagcagcgtgcccagggcctcttcaagccggttcctgccaaggcg
cccaccctgaagggcaacccggcatcgccggttaaagtggagctcggcaagatgctctat
ttcgacccgcggctgtccgcctcccatctcatcagctgcaatacctgtcacaacgtggga
ctgggcggcggggacctccaggcaacctccaccggccacggctggcaaaaggggccccgc
aatgcaccgacggttctcaactcggtcttcaacaccgcccagttctgggacggcagggcc
aaggatctggccgaacaggccaaaggtccggtgcaggcctcggtcgagatgaacaacacg
ccggatcaggtggttaagaccctgaacagcatccccgactatgtcgccctgtttaaaaag
gcgttcccgggcgaaaaggacccggtgaccttcgacaacatggcaaaggccatcgaggtg
ttcgaggcgaccctgatcacccccgactcccccttcgaccagtatctcaaagggaagaaa
aaggcccttgacggaaaacagaccgccggcctcaagcttttcctcgacaaaggctgcgtc
gcctgccatggcggcctcaatctgggcggtaccggctacttcccgttcggggtcgtggaa
aagcccgcggagaacatccttcccctcggcgacaagggaaggtttgcggtcacgaacacc
gccaaggacgagtacgtgttccgggcgccctccctgcgcaacgtcgccatcacctatccc
tacttccattcgggcgtcgtctggagcctgaaggaagcggtggccgtcatgggttccgcc
cagttcggcatcaagctgagcgatgatgaaagcgaggccattgcagccttcctcggcagc
ctcaccggcaagcaacccaaagtcgtgtatccgatcatgccggccagcaccgacgcaaca
ccgcgccccagactgtaa

DBGET integrated database retrieval system