KEGG   Geobacter sulfurreducens PCA: GSU2979Help
Entry
GSU2979           CDS       T00155                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
gsu  Geobacter sulfurreducens PCA
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gsu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    GSU2979 (folK)
Enzymes [BR:gsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     GSU2979 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(3270636..3271127)
Genome map
AA seq 163 aa AA seqDB search
MESNVFIALGSNMGDRELNLLRAVAEIGKLPETRITALSGFYETEPVGPVPEQPDFLNAV
LRIETSLTPHRLLEELQRIETGLFGRRREMYQGPRSMDLDILLYGSLTVAVEGLVIPHPR
LHQRHFVLVPLAEIAPDMIHPVQEKPVRELLASLPPGERVTKT
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
gtggaatccaacgtcttcatagccctcggttcgaacatgggggaccgggagctgaacctg
ctgcgcgcagttgccgagatcggcaaactgccggaaacccgaataaccgctctttccggc
ttctacgaaaccgagccggtggggccggtgccggaacagcccgacttcctcaacgcggtc
ctgcggatcgaaacctcgctcacccctcaccggctcctcgaagaactccagcggatcgaa
accggcctgttcggcaggcgccgggagatgtatcaggggccgcgttcaatggatctggat
atcctcctctacgggagcctgaccgttgccgtcgaagggctcgtcattccccatccccgg
ctccatcagcggcacttcgtactggtccccttggcggagattgcgccggatatgattcat
cccgtgcaggagaagccggtgcgggagctgctcgcttccctgccgccgggggagcgcgtc
accaaaacttag

DBGET integrated database retrieval system