KEGG   Geobacter sulfurreducens PCA: GSU3100Help
Entry
GSU3100           CDS       T00155                                 

Gene name
hisD
Definition
(RefSeq) bifunctional histidinal dehydrogenase/histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
gsu  Geobacter sulfurreducens PCA
Pathway
gsu00340  Histidine metabolism
gsu01100  Metabolic pathways
gsu01110  Biosynthesis of secondary metabolites
gsu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gsu00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    GSU3100 (hisD)
Enzymes [BR:gsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     GSU3100 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-GeneID: 2688475
NCBI-ProteinID: NP_954141
UniProt: P60859
Position
complement(3403585..3404874)
Genome map
AA seq 429 aa AA seqDB search
MRFLDIRDTNFDAEFAAILARGEETGREVEQVVLDIIADVRARGDEALLEYTRRFDRLEA
DSVAALQVTEDEIEYAFAKVKDEEIAALKLAVERVARFHEKQKQETWLSTTEPDILLGQM
VTPLERVGIYVPGGKASYPSSVIMNAVPARVAGVGEIVMVAPTPGGEINPHVLVAARLSG
VDRIFRMGGAQAVAALAYGTATVPRVDKITGPGNIYVATAKKLVFGQVGIDMIAGPSEIL
VINDGSGTPAHIAADLLSQAEHDELASSILITTDRGFGEQVATEVERQLAQLSRETIART
SWETYGAVIVAGSLDEAIAFSNRIAPEHLELAVANPFEILPRIKNAGAIFLGHFTPEAAG
DYLAGPNHTLPTGGTARFFSPLSVDDFVKKSSIVYFSAAGLNRLGRDIVSIAEMEGLEAH
GRSVSIRLK
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgagattcctcgacatcagggatacgaactttgacgcggaattcgctgccatcctcgcc
cggggcgaggagaccggccgcgaggtggagcaggtggttctcgacatcatcgccgatgtc
cgtgcacggggagacgaggcgctcctggagtacacccggcgcttcgaccggcttgaggcc
gactccgtcgccgccctccaggtgaccgaggacgagatcgagtacgcctttgccaaggtg
aaggacgaggagattgccgccctcaagctggcggtggagcgggtggcccgcttccacgag
aagcagaagcaggagacctggctctccaccaccgagccagacatccttctcggtcagatg
gtgacgcccctggagcgggtcgggatctacgttcccggcggcaaggcgagctacccttcc
agtgtcatcatgaatgcagttccggcccgagtggccggcgtcggcgagatcgtcatggtg
gcccctacccccggcggcgagatcaacccgcacgttctggtggcggcgcggctttccggt
gttgaccggattttccggatgggaggcgcccaggcggtggcggccctggcctatgggacc
gcgacggtgccccgggtggacaagatcaccggcccggggaacatctacgtggccaccgcc
aaaaagctcgtcttcggccaggtggggatcgacatgatcgccggacccagcgagattctc
gtcatcaacgacgggagcggcaccccggcccacatcgccgccgacctcctttcccaggcg
gagcacgacgaacttgcttcatccatcctcatcaccaccgaccgcggtttcggcgagcag
gtggcgacggaggtggagcggcaactggcgcaactctcccgggagaccatcgcccgcacg
tcgtgggagacctacggcgcggtcatcgtggccggtagcctggacgaggccatcgctttc
tcgaaccggatcgccccggagcacctggagcttgctgtggcaaatcccttcgagatactg
ccgcggatcaaaaacgccggtgctatcttcctcggccacttcacccccgaggcggccggc
gactacctggccggcccgaaccacacccttcccaccggcggtacggcccgtttcttctcc
ccactgtcggtggacgatttcgtgaagaaatcctctatcgtctacttcagtgcggcgggg
ttgaaccgtctgggccgcgacatcgtcagtattgccgagatggaggggctggaggcccac
ggcaggtcggtaagcatccgcctgaaataa

DBGET integrated database retrieval system