KEGG   Geobacillus thermoleovorans: GTCCBUS3UF5_10420Help
Entry
GTCCBUS3UF5_10420 CDS       T01676                                 

Definition
beta-galactosidase ganA
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
gte  Geobacillus thermoleovorans
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:gte00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
969325..971385
Genome map
AA seq 686 aa AA seqDB search
MPKYERTYITQANFILHGGDYNPDQWLDRPDLLQADLELMKLSHTNTFTIGVFAWSALEP
EEGVYRFEWLDKVFDDIYRIGGRVILATPSGARPAWLSQKYPEVLRVNAARVRQLHGGRH
NHCFTSSVYREKTQHINRLLAERYGDHPALLMWHVSNEYGGECHCNLCQEAFREWLKNRY
NHDLDALNAAWWTSFWSHTYTDWSQIESPSPIGEHTIHGLNLDWKRFVTDQTISFFENEI
VPLRELTPHIPITTNFMADTHDLIPFQGLDYSKFAKHLDVISWDAYPAWHNDWESTADLA
MKVGFINDLYRSLKQQPFLLMECTPSLVNWHKVNKAKRPGMHFLSSMQMIAHGSDSILYF
QWRKSRGAFEKLHGAVVDHDNRTDNRVFQEVSKVGKALEKMSGIVGTNRSAEVAILYDWE
NNWALNDAQGFATETKRYPQTLVQHYRPFWERDIPVDVITKEQDFSRYKLLIAPMLYLVS
EETIARLKQFVGSGGTLVMTYISGMVNECDLAYLGGWHPDLRKTFGIEPIETDTLYPRDR
NSVHYRGQSYELKDYATVIKVYTATVEGVYEDDFYAGTPAVTSNQYGKGQAYYIGGRLED
QFHRDFYQELMEKLDLRPVLFVKHGKGVSVQARQAPECDYVFIMNFTEEKQAVVVEEKVK
DLFTGEEIEGEITLGKYEVRVVEKRR
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaatatgaacgaacgtatataacacaagcgaacttcattcttcatggaggagat
tacaaccctgatcaatggttggatcggccggatcttttgcaggcggatcttgagttgatg
aaactctcccacacaaacacattcacgattggtgtatttgcttggtctgctctcgaaccg
gaagaaggggtttatcgttttgaatggctcgataaagtgtttgacgacatttaccgtatt
ggcgggcgggtgattttggctacgccaagcggtgctcgaccagcatggttgtcgcaaaag
tatccggaagtgttgcgggtgaatgcggcgcgtgttcgacagttgcatggcgggcgtcat
aatcattgttttacctcgagcgtataccgtgaaaaaactcaacatatcaatcgattgctg
gcggaacggtacggagatcatcctgctttgctcatgtggcacgtttccaatgaatacggc
ggggaatgccattgtaatttgtgccaagaagcgtttcgtgaatggttgaaaaacagatac
aatcatgatcttgacgcgctgaatgccgcttggtggacgtcattttggagccatacgtac
accgactggtcgcaaatcgagtcgccgtctccgattggtgagcatacgattcatgggttg
aatcttgattggaaacggtttgtgacagatcagacgatttccttttttgaaaacgagatc
gttccgcttcgggagttgacgcctcatattccgattacaacgaattttatggcggatacg
catgacttaattccttttcaaggacttgactacagcaagtttgcgaagcatcttgacgtc
attagttgggacgcctatcctgcttggcacaatgattgggagagcactgccgatttggct
atgaaagtcggttttatcaatgatttgtatcgaagtttgaagcagcagccatttttactg
atggaatgcacgccgagtttggtgaactggcataaagtgaacaaagcgaagcggccaggc
atgcactttttatcttcgatgcaaatgatcgctcatggttccgacagcatcctctatttt
caatggcgcaagtcgcggggggcgtttgagaaacttcacggtgcggtcgtcgaccatgac
aatcgcacggataaccgtgtatttcaagaagtttctaaagttgggaaagcactcgagaaa
atgtctggcatcgtcggaaccaatcggtcggcggaagtggccattttgtatgattgggaa
aacaattgggcgttaaatgatgcgcaaggatttgcgactgaaacgaaacggtatccacaa
acgctcgtacagcattatcgccccttttgggagcgggatatccctgttgatgtcatcacg
aaggaacaagacttttcccgctacaaattgctgattgcgccgatgctttacttagtgagc
gaagagacgattgctcgtttgaaacagtttgtagggagcggtggaacgcttgtcatgact
tatataagtggaatggtcaatgaatgtgatttagcgtatttaggtggctggcatcccgat
ttgaggaaaacattcggcatcgaaccgatcgaaacggatactctttatccacgcgatcga
aattcggttcattatcgtggacagtcttacgagttgaaagactatgcaacggtgatcaag
gtgtatactgcaacagtcgaaggagtttatgaagatgatttttatgcgggtacgcccgct
gtgacgagcaaccaatacgggaaaggtcaagcctattatattggcggccgcctagaggat
caattccatagagatttttatcaagaattgatggaaaagctcgatttgaggcctgtcttg
tttgtaaagcatggaaaaggagtatccgtccaagcgcggcaagccccggaatgtgattat
gtgtttattatgaattttacggaggagaaacaggctgttgttgttgaggaaaaggtgaag
gatctgttcactggcgaggaaatcgaaggggagatcacgctaggtaaatacgaggtgcga
gtcgtggagaaaaggagataa

DBGET integrated database retrieval system