KEGG   Geobacillus thermoleovorans: GTCCBUS3UF5_10500Help
Entry
GTCCBUS3UF5_10500 CDS       T01676                                 

Definition
glycoside hydrolase, family 1
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
gte  Geobacillus thermoleovorans
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:gte00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
978643..980085
Genome map
AA seq 480 aa AA seqDB search
MVTTNEAFPTNFLWGGATAANQIEGGFGEGNKGVSIADVLPGGKMRQQLLREKGLQFAID
KEKYTYPNHEAIDFYHRYKEDIALFAEMGFKAFRLSIAWTRIFPNGTELEPNEEGLAFYD
RVFDELHKYGIEPVVTISHYEMPLHLAKEYGGWRSRELVTLFERYAKVIFQRYKDKVKYW
LTFNEINGALHFPLMSMGFVPESEETKYQELFQAFHHQFVASSLAVKACREIIPDAKIGC
MILAAPVYPYDCNPENVMHALEEERLLNFFCADVQVRGEYPSFMKRVFDERGVKLDIRDG
DLELIKKHTVDYIGLSYYMSVTQKKDKMDDELIPGSVFDGVKNPFLKASDWGWEIDPIGL
RIILNRLYDRYRVPLFIVENGLGAHDKVEEDGSIHDDYRIDYLRRHIEAAREAIADGVEL
IGYLVWGCIDLVSASTGEFSKRYGLIYVDKHDDGSGTLERRKKKSFDWYQNVIATNGEEL
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
gtggttacaacgaacgaggcgtttcccaccaactttttatggggaggagcgacggcggcc
aaccagatcgaaggaggatttggcgaaggaaacaaaggggtaagcattgccgatgtgctt
ccgggaggaaagatgaggcaacaactgcttagggaaaaagggttgcagtttgccattgat
aaggagaagtacacatacccgaaccatgaagcgatcgacttttaccaccggtataaagag
gatatagccctgtttgctgagatgggatttaaagcgttccgcctatcgatcgcctggacg
cgcatcttcccgaacggcaccgagcttgagccaaatgaagaagggcttgccttctatgat
cgggtgttcgatgagttacataaatacgggattgagccggtggtgacgatttcccattat
gaaatgccgctccatttggccaaagaatacggtggctggcggagccgcgaactggtaacg
ttgtttgaacgttacgccaaggtgattttccagcgttataaagataaagtgaaatattgg
ctgacgtttaacgaaataaacggtgcgctccattttccgctcatgagcatgggatttgtg
ccggaaagcgaagagacgaaatatcaagagttgtttcaagcgttccatcatcaatttgtc
gccagcagcctggcggtgaaggcgtgccgcgagatcattccggacgcaaaaatcggctgc
atgattctcgccgcccccgtgtacccgtacgactgcaatccagaaaacgtcatgcatgca
cttgaagaggagcggctgttgaatttcttttgcgccgacgttcaagtgcgcggcgagtat
ccatcctttatgaaacgcgtgttcgacgagcgcggggtgaaactcgatattcgcgacggg
gatttggaactgatcaagaagcatacggtcgactatatcggtttaagctactatatgtcc
gtcacccagaaaaaagacaagatggatgatgagctcatccccggcagcgtatttgatggg
gtgaaaaacccgttccttaaagcgagcgactggggctgggagatcgaccctatagggctg
cgcatcattttaaaccggttgtacgatcggtatcgcgtaccgctttttattgtggaaaac
gggcttggggcgcatgacaaagtggaagaagacggctcgattcacgacgattaccgcatt
gactatttgcgccgtcatatcgaagcagcgcgtgaagcgatcgccgatggcgtcgaattg
attggctatctcgtatggggctgcattgacctcgtgagcgcctcgaccggcgagttttca
aaacggtacgggttgatttacgtcgataaacacgatgacggcagcggcacgctcgagcgg
agaaagaaaaagtcgtttgattggtatcaaaacgtcatcgcgacgaacggggaagagtta
taa

DBGET integrated database retrieval system