KEGG   Geobacillus thermoleovorans: GTCCBUS3UF5_10760Help
Entry
GTCCBUS3UF5_10760 CDS       T01676                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
gte  Geobacillus thermoleovorans
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:gte00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1003360..1005267
Genome map
AA seq 635 aa AA seqDB search
MCGFIGCIHDRPRAIEQTWKTTLVEMNRLITHRGPDDEGYFFDDYVSFGFRRLSIIDLEA
GHQPLSYENDRYWIIFNGEIYNYLELREELAAKGYSFATHSDTEVIVALYSAEKEKAVEK
LRGMFAFVIWDKQEKTVFAARDPFGIKPFFYAEQGDRTFFASEKKSILLALRQESPNGDS
LQHYLTFQYVPEPLTMSAGIYKLEPGHYLKKKVGKPLTIHRYWKASFEPIRQSEEELVKK
IRDALFDSVNVHMRSDVPVGAFLSGGIDSSFIVAIAKQFHPHLKTFSVGFEREGFSEIDV
AKETAEKLGVDNISYVISPQEYMEELPKIMWHMDDPLADPAAVPLYFVAREARKHVTVVL
SGEGADELFGGYNIYREPESLRLFARMPNIVKAVLRVIAKMLPDGMKGKSFLERGTTPLE
ERYVGNAKIYSEKEKAALLKTYQEGREYTAVTAPFYRETLHYPPVNRMQYIDLHTWLRGD
ILVKADKMTMAHSLELRVPFLDKKVFEVARQIAPDMKTANGTTKYILRKAAEGIVPDHVL
NRKKLGFPVPIRHWLKNEMYDWARQLINESETDHLFHKDVLYRLLDEHARHKADHSRKLW
TVLAFMVWHQVYVEKKYDFAQSVQNEKRPASVLEA
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggttttattggctgtattcatgatcgcccaagagcgattgagcaaacatggaaa
acaacgttggtggagatgaaccgcctgattacccatcgcggccccgacgatgaggggtat
ttttttgatgactacgtgagttttggttttcggcgtttgagcatcatcgatctggaggcg
ggacatcagccgctgtcttatgaaaacgatcgatattggatcatttttaacggggaaatt
tacaactatcttgaattgcgggaagagctggcggcgaaaggatattcgtttgcgacgcat
tcggataccgaggtgattgttgccctttacagcgcggaaaaagaaaaagcggtcgaaaag
ctgcgcgggatgtttgcgtttgtcatttgggacaagcaagagaaaacggtgtttgcggcg
cgggatccgttcggcattaagccgtttttttatgcggagcaaggagatcgcacgtttttc
gcttcggaaaagaaaagcatcttgctggccctcagacaggaatcgccaaacggtgattcc
ctgcagcattatttaacattccaatatgtccctgagccgctgacgatgtcggccggcatt
tacaagctggagccggggcattatctcaagaaaaaagtcggaaaaccgctcaccattcat
cgttattggaaggcatccttcgagcccattcgccaatcggaagaggagcttgtaaagaaa
atccgcgatgcgctgtttgattcggtcaacgtccatatgcgcagcgatgtgccggtcggt
gcgtttttgtcgggaggcattgattcatcgttcatcgtcgccatcgcgaaacaattccat
ccgcacctgaagacattttccgtcgggtttgagcgggaagggttcagtgaaatcgatgtc
gcaaaagaaaccgcagagaagcttggggtagacaacattagctatgtcatctcaccgcag
gagtatatggaagagctgccgaaaattatgtggcatatggacgatccgcttgccgatcct
gcggctgtgccgctgtattttgtcgctcgtgaggcgagaaagcatgtcacggttgtgctt
tccggcgagggggcggacgagctgtttggcggctacaacatttaccgcgaaccagagtcg
ttgcggctgtttgcgcgcatgccaaacatcgtaaaagcggtgttgcgggtgatcgcgaag
atgcttccggacggaatgaaaggaaaaagctttttggagcgcggaacgacgccgcttgaa
gaacggtatgtcggcaatgcgaaaatctatagcgaaaaggaaaaagcggcgttgctcaaa
acgtaccaagaggggcgcgaatatacggcggtgacggctcctttttaccgcgaaacgctt
cattacccacccgtcaaccggatgcagtatattgatcttcatacatggctaaggggcgat
attttagtcaaagcggacaaaatgacgatggcccattcgcttgagctgcgcgttcccttt
ttagacaaaaaggtatttgaggttgctaggcaaatcgcccctgacatgaaaacagccaac
ggcacgacgaaatatattttgcgcaaagcggccgagggcatcgtaccggatcatgtgtta
aaccggaaaaaattagggtttcccgtgccgattcgccactggctgaaaaacgaaatgtat
gactgggcgagacagctcatcaacgaaagcgaaactgatcatctgttccataaggacgtg
ctctatcggctgctggatgaacatgcccgccacaaggcggatcatagccgcaagctgtgg
acggtcttggcgtttatggtttggcatcaagtctatgtggaaaagaagtacgattttgct
caatccgtacaaaacgagaaacggccagcgtctgttttggaggcgtag

DBGET integrated database retrieval system