KEGG   Geobacillus thermoleovorans: GTCCBUS3UF5_11990Help
Entry
GTCCBUS3UF5_11990 CDS       T01676                                 

Definition
Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
gte  Geobacillus thermoleovorans
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:gte00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GTCCBUS3UF5_11990
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GTCCBUS3UF5_11990
  Amino acid metabolism
   00310 Lysine degradation
    GTCCBUS3UF5_11990
Enzymes [BR:gte01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     GTCCBUS3UF5_11990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1118972..1120240
Genome map
AA seq 422 aa AA seqDB search
MAEIKVPELAESITEGTIAQWLKKPGDYVEKGESICELETDKVNVEIMAEESGVLQQLLA
NEGDTVAVGQAIAIIGEGAAAPTAALQAAPQPADETETVAPADSNEQPAPQPVAVAQAPS
QRPIASPAARKMAREKGIDLTQVPTADPLGRVRKQDVASFAAQPAAAPQPAPQAAPTSTP
AAVPAAEAGKPVIREKMSRRRQTIAKRLLEVTQTTAMLTTFNEIDMSAVIDLRKRKKDKF
FEEHDVRLGFMSFFVKAAVAALKKYPYVNAEIQGDEILLKKYYDIGVAVSTDEGLVVPVV
RDCDRKNFAEIERDIAELAAKARSNKLSLADLQGGTFTITNGGVFGSLLSTPLLNGPQVG
ILGMHSIKLRPVAVDEERIENRPMMYVALSYDHRIIDGKEAVGFLKTVKDLIENPEDLLL
ES
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
gtggctgagatcaaagtcccagagttagcagaatccatcacggagggaacgatcgcccaa
tggctgaaaaaaccgggcgactacgtggaaaaaggagaatcgatttgcgagcttgaaacg
gataaagtgaacgtggaaattatggcggaagagtcgggtgttttgcaacagctgctggcc
aatgaaggcgatacggttgcggttggccaagcgatcgccattatcggcgaaggagcggca
gcaccgactgccgctttgcaagctgctccgcagccagccgatgaaacggaaacggtcgcg
ccggccgacagcaatgaacagccagcgccgcagccagtcgcggttgcccaggcgccgagc
cagcggccaatcgcctctccggccgcccggaaaatggcacgtgaaaaagggatcgacttg
acgcaagtgccaacggctgatccgcttgggcgcgtgcgcaaacaagacgtcgcctcgttt
gccgcacaaccggccgccgctccgcagccggctccgcaagccgcgccgacgtcgacgccg
gccgccgttccagccgctgaggccggcaagccggtcatccgcgaaaaaatgtcgcgccgt
cggcaaacgatcgccaaacggctgctggaagtgacgcaaacgaccgcgatgttgacgaca
tttaacgaaattgacatgtcggcggtcatcgatttgcgcaagcggaaaaaagataaattt
ttcgaagagcatgacgtccgccttggctttatgtcgtttttcgtcaaagcggctgtcgcg
gcgctgaaaaaatatccgtacgtcaacgcggagatccaaggcgatgagattttgctgaaa
aaatattacgatatcggcgttgccgtatcgacggatgaagggcttgtcgttccggttgtg
cgcgactgcgaccggaaaaacttcgccgaaattgagcgcgacattgccgaattggcagcg
aaagcgcgcagcaacaagttgtcgctcgccgatttgcaaggcggcacgtttacgatcacg
aacggcggtgtgttcggttcgcttctgtcgaccccgcttctcaacgggccgcaagtcggc
attttagggatgcattcgatcaaactgcgtccggtcgccgtcgatgaagagcggatcgaa
aaccgtcccatgatgtacgtcgccttgtcatacgaccaccgcatcatcgatggcaaagag
gccgtagggttcttaaaaacggtgaaagacttgatcgaaaatccggaagatttgctgctt
gaaagttga

DBGET integrated database retrieval system