KEGG   Geobacillus thermoleovorans: GTCCBUS3UF5_13000Help
Entry
GTCCBUS3UF5_13000 CDS       T01676                                 

Definition
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
gte  Geobacillus thermoleovorans
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:gte00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:gte00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1202957..1204426
Genome map
AA seq 489 aa AA seqDB search
MKLLTLLSHLPGFWVHHGGNPDIVALEMDSRRVASGSLFFCLKGFTVDGHDFAEEAVARG
AAAIVAERPLSVDVPVVLVSDSRRTMAILADAFYGRPTHRLHLIGVTGTNGKTTTTSIIE
QIARKAGKKTGLIGTVHIKVGDRSYPAANTTPESLILQRMFKQMVDEGVEFVAMEVSSHA
LHQGRVHGCDYDVAVFTNLTQDHLDYHGTMEEYRNAKGLLFAQLGNRYDERRPKFAVLNH
DDPVSQYYKHMTAAPIVTYGMREKSDVMAEQIRMTAGGMAFRLCTPHGSAAVETKLVGSF
NVYNILAAAAACLASGFSLETIAAALADVEPVPGRFETVDEGQNFTIIVDYAHTPDSLEN
ALKTVRQLAKRNVYVVIGCGGDRDPSKRPLMAQVAVRYADVAIFTSDNPRSEDPKQILRD
MEAGVSAEIGKHVTIPDREEAIRYAIGQAQEGDVVLIAGKGHETYQIIGNDVIEFDDRAV
ARAAVKERG
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgctgacgctgctgtcacacttgcccggtttttgggtgcaccatggaggcaat
cccgatatcgtggcgctcgaaatggactcgcgccgcgttgcctccggttctctctttttt
tgccttaaagggtttacagtagacggacacgactttgccgaggaagcggtggcgcgcgga
gcggcggcgatcgtggccgagcggccgctttccgttgatgttcccgtcgttcttgtgtcg
gacagccggcggacgatggcgattttagcggacgcgttttacgggcggccgacccaccgc
ctacatttaatcggagtgacaggcacaaacggcaagacgacgacaacgtcgatcatcgaa
caaatcgcgagaaaagccggcaagaaaacagggctcattggcacggttcacatcaaggtc
ggcgaccgctcctatccggcggccaatacgacgccggagtcgctcattttgcagcgcatg
tttaaacagatggtcgatgaaggagtggagtttgtcgccatggaagtgtcgtcgcacgcg
ctgcaccaagggcgggtgcatggctgcgattacgatgtggccgtctttacgaacttaacg
caagaccatttggattatcacgggacaatggaagaatatcggaacgccaaagggcttttg
tttgcccagctcggcaaccgctacgacgaacggcggccgaaatttgccgttctcaatcat
gacgatccggtttcgcagtattataaacatatgacggccgcgccgatcgtcacatacggg
atgagggaaaaaagcgatgtgatggcggaacagatccgcatgaccgcaggcggcatggcg
tttcggctttgcacgccgcacggatcggcggcggtcgaaacgaaacttgtcggctcgttc
aatgtctataacattctcgccgctgccgctgcctgccttgcctctggcttttcgcttgaa
acgatcgccgcggcgcttgcggatgtcgagccggtgccggggcggtttgaaacggttgat
gaagggcaaaactttacgatcatcgtcgattacgcccacacgccggacagtttagaaaat
gccttaaaaacggtgcgccaattggcgaagcgaaacgtgtatgtcgtcatcggctgcggc
ggcgaccgcgacccgtcgaaacggccgctcatggcgcaggtggcggtgcggtatgcggat
gtcgctatttttacctccgacaatccgcgttcggaagacccgaagcaaattttgcgcgac
atggaagcgggagtaagcgctgagatcggaaagcatgtgacgattcctgaccgtgaagag
gcgatccgctacgccattggccaggcgcaggaaggcgatgttgtgttgattgccggcaaa
gggcatgaaacgtatcaaatcattggcaacgatgtgattgagtttgacgatcgcgctgtt
gcccgagcggcagtgaaggagagaggatga

DBGET integrated database retrieval system