KEGG   Geobacillus thermoleovorans: GTCCBUS3UF5_13380Help
Entry
GTCCBUS3UF5_13380 CDS       T01676                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
gte  Geobacillus thermoleovorans
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gte00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    GTCCBUS3UF5_13380
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    GTCCBUS3UF5_13380
Enzymes [BR:gte01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     GTCCBUS3UF5_13380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1235316..1236338
Genome map
AA seq 340 aa AA seqDB search
MHLLRLCHAPIVTPCLAGKVFFFAKKRKGARPMTHLFALSELPLDEIHRLLDEAEAFRSG
RIWRPAAPMYVANLFFEPSTRTKCSFEMAERKLGLHVIPFDPERSSVQKGETLYDTVRTL
EAIGVDAVVIRHHEDAYFEALRHAVGIPIINAGDGCGHHPTQSLLDLLTIRQEFGAFTGL
TVAIIGDIRHSRVARSNAEVLTRLGANVLFSGPEEWKDETNPYGTYVEVDEAIARADVVM
LLRIQHERHAETMGLTKEEYHARYGLTLERARRMKSGAIILHPAPVNRGVEIASELVEAK
ASRIFKQMENGVYVRMAVLKRAMEGRMEHGRMAEKWHVVQ
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
gtgcaccttcttcggctctgccatgcgccgatcgtcacaccttgcctggccggcaaggtg
ttttttttcgcgaaaaaacgaaaaggagcgagaccgatgacccatcttttcgcattaagt
gaactgccgcttgatgaaatccaccgtttgctcgatgaagcggaagcgttccgcagcggg
cgcatctggcgcccggcggcgccgatgtacgtcgccaacttgtttttcgaaccgagcacg
cgcacgaaatgcagcttcgagatggcggaacggaagcttgggcttcatgtcattccattt
gacccggaacgctcgagcgtgcaaaaaggggagacgctgtacgataccgtacggacgctt
gaggcgatcggcgtcgatgcggttgtcatccgccatcacgaagatgcgtatttcgaagcg
ctccgccatgcggtcggcattccgatcatcaacgccggcgacggctgcgggcaccatccg
acccagtcgctcttggatttattgacgatccgccaagagtttggcgccttcactggcttg
acggtggcgatcatcggcgacatccgtcatagccgcgtcgcccgctccaatgcggaagtg
ttgacaaggctgggggcaaacgtcctgttttccggaccggaagagtggaaagatgaaacg
aatccgtacgggacgtacgtcgaagtcgacgaggccatcgcccgcgccgatgtcgtgatg
cttttgcgcatccaacatgaacgccatgcggaaacgatggggctgacaaaagaagagtac
catgcgcggtacgggctgacgcttgagcgggcgcggcggatgaaatcgggcgccatcatc
ttgcacccggcgccggtcaaccgcggggtcgaaatcgcaagcgaacttgtcgaagcgaag
gcatcgcgcatttttaaacaaatggaaaacggcgtctacgtccggatggctgtcttaaaa
cgggcaatggaagggagaatggagcatgggcgtatggctgaaaaatggcatgtcgttcaa
taa

DBGET integrated database retrieval system