KEGG   Geobacillus thermoleovorans: GTCCBUS3UF5_13550Help
Entry
GTCCBUS3UF5_13550 CDS       T01676                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
gte  Geobacillus thermoleovorans
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:gte00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    GTCCBUS3UF5_13550
Enzymes [BR:gte01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     GTCCBUS3UF5_13550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1253639..1254235
Genome map
AA seq 198 aa AA seqDB search
MIVMSGPSGVGKGTVRKALFSQPDINLHYSVSVTTRKPREGEVEGVDYFFRTREQFEQMI
RENKLLEWAEYVGNYYGTPIDYVEKTLAEGKDVFLEIEVQGAMKVRRAFPEALFIFLAPP
SLTELEKRIMGRGTESKELIENRLRAAKEELEMMDEYDYVVENDEVELACERIKAIVIAE
HCRRERVAERYKRMLGVE
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
ttgatcgtcatgtcgggtccgtctggcgttggcaaaggaacggtgcgcaaggcgctgttt
tcgcagccggacatcaatcttcattattcggtgtcggtcacgacgcgcaagccgcgcgaa
ggcgaagtggaaggcgtcgactacttcttccgcacgcgcgagcagtttgaacaaatgatt
cgggaaaacaagctgctcgagtgggcggaatacgtcggcaactactatggcacgccgatc
gactacgtggagaagacgcttgccgaagggaaagatgtgtttttagagatcgaagtgcag
ggagcgatgaaagtacggcgggcgtttccagaggcgctcttcattttccttgctccgcca
agcctcacggagcttgaaaagcggatcatgggacgcggcaccgagtcgaaagagctgatt
gaaaatcggctgcgggcggcgaaagaggagcttgaaatgatggacgagtacgactatgtc
gtggaaaatgatgaagtggagctcgcctgcgagcggatcaaggcgatcgtcatcgccgaa
cattgccggcgcgaacgcgtcgccgagcgatataaacggatgttgggggtggaatga

DBGET integrated database retrieval system