KEGG   Geobacillus thermoleovorans CCB_US3_UF5: GTCCBUS3UF5_13990Help
Entry
GTCCBUS3UF5_13990 CDS       T01676                                 

Definition
(GenBank) Succinyl-CoA ligase [ADP-forming] subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
gte  Geobacillus thermoleovorans CCB_US3_UF5
Pathway
gte00020  Citrate cycle (TCA cycle)
gte00640  Propanoate metabolism
gte00660  C5-Branched dibasic acid metabolism
gte01100  Metabolic pathways
gte01110  Biosynthesis of secondary metabolites
gte01120  Microbial metabolism in diverse environments
gte01130  Biosynthesis of antibiotics
gte01200  Carbon metabolism
Module
gte_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gte_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:gte00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GTCCBUS3UF5_13990
   00640 Propanoate metabolism
    GTCCBUS3UF5_13990
   00660 C5-Branched dibasic acid metabolism
    GTCCBUS3UF5_13990
Enzymes [BR:gte01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     GTCCBUS3UF5_13990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AEV18712
UniProt: G8N1A4
Position
1292158..1293318
Genome map
AA seq 386 aa AA seqDB search
MNIHEYQAKEILRSYGVSVPNGRVAFTVDEAVEAAKELGAPVCVVKAQIHAGGRGKAGGV
KVAKSLEEVRTYASELLGKVLVTHQTGPEGKEVKRLLIEEGCDIQKEYYIGLVVDRATSR
VVLMGSEEGGTEIEEVAAKTPEKIFKEYIDPAVGLQAFQARRLAFNINIPKHLVNQAVKF
MMGLYQVFVDKDCSIAEINPLVVTGDGKVMALDAKLNFDSNALYRHPDVLEYRDLDEEDP
KEVEASKYDLNYIALDGNIGCMVNGAGLAMATMDIIKYYGGEPANFLDVGGGASEEKVTE
AFKIILSDPNVKGIFVNIFGGIMKCDVIASGIVAATKQVGLTLPLVVRLEGTNVELGKKI
LQESGLNIIAAESMADGAQKIVELVR
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaacattcatgaataccaagcaaaagaaattttgcgaagctatggtgtgagcgtgccg
aacggccgcgtcgcgttcacggtggatgaagcggtcgaagcggcgaaagagctcggcgcg
ccggtgtgtgtcgtcaaagcgcaaattcatgccggcgggcgcggcaaagcgggcggggtg
aaagtggcaaaaagcctcgaggaagtccgtacatacgccagcgaattgctcggcaaagtg
ctcgtcacccatcaaaccggcccggaaggaaaagaagtgaaacggctgttgattgaagaa
gggtgcgacatccaaaaagaatactacatcggccttgtcgtcgaccgcgccacctcgcgc
gtcgtgttaatggggtcggaagaaggcggcacggaaatcgaagaagtcgcggcgaaaacg
ccggagaaaattttcaaagagtacattgacccggccgtcgggctgcaggcgttccaagcg
cgccgcttggcgttcaacatcaacattccgaagcatctcgtcaaccaagcggtcaaattt
atgatgggcttgtaccaagtgtttgtcgacaaagactgctcgatcgccgaaatcaacccg
cttgtcgtcaccggcgacggcaaggtgatggcgcttgacgcgaagctgaactttgattcg
aacgcgttgtaccgccacccggacgtgctcgaataccgcgatttggacgaagaagatccg
aaagaggttgaagcatcgaaatacgacttgaactacatcgcccttgacggcaacatcggc
tgcatggtcaacggcgccggcttggcgatggcgacgatggacatcatcaaatattacggc
ggcgagccggccaacttcctcgatgtcggcggcggcgccagcgaggaaaaagtgacggaa
gcgttcaaaatcattttgtcggacccgaacgtgaaaggcattttcgtcaacattttcggc
ggcattatgaaatgcgacgtcatcgcgagcggcatcgtcgcagcgacgaagcaagtcggt
ttgacgcttccgcttgtcgtccggcttgaaggaacgaacgttgagcttgggaaaaagatt
ttgcaagagtcaggcttaaacattattgcggccgaatcgatggcggacggagcacaaaaa
atcgtcgagctagtacgttaa

DBGET integrated database retrieval system