KEGG   Geobacillus thermoleovorans: GTCCBUS3UF5_13990Help
Entry
GTCCBUS3UF5_13990 CDS       T01676                                 

Definition
succinyl-CoA ligase [ADP-forming] subunit beta
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
gte  Geobacillus thermoleovorans
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gte00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GTCCBUS3UF5_13990
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GTCCBUS3UF5_13990
   00640 Propanoate metabolism
    GTCCBUS3UF5_13990
   00660 C5-Branched dibasic acid metabolism
    GTCCBUS3UF5_13990
Enzymes [BR:gte01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     GTCCBUS3UF5_13990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1292158..1293318
Genome map
AA seq 386 aa AA seqDB search
MNIHEYQAKEILRSYGVSVPNGRVAFTVDEAVEAAKELGAPVCVVKAQIHAGGRGKAGGV
KVAKSLEEVRTYASELLGKVLVTHQTGPEGKEVKRLLIEEGCDIQKEYYIGLVVDRATSR
VVLMGSEEGGTEIEEVAAKTPEKIFKEYIDPAVGLQAFQARRLAFNINIPKHLVNQAVKF
MMGLYQVFVDKDCSIAEINPLVVTGDGKVMALDAKLNFDSNALYRHPDVLEYRDLDEEDP
KEVEASKYDLNYIALDGNIGCMVNGAGLAMATMDIIKYYGGEPANFLDVGGGASEEKVTE
AFKIILSDPNVKGIFVNIFGGIMKCDVIASGIVAATKQVGLTLPLVVRLEGTNVELGKKI
LQESGLNIIAAESMADGAQKIVELVR
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaacattcatgaataccaagcaaaagaaattttgcgaagctatggtgtgagcgtgccg
aacggccgcgtcgcgttcacggtggatgaagcggtcgaagcggcgaaagagctcggcgcg
ccggtgtgtgtcgtcaaagcgcaaattcatgccggcgggcgcggcaaagcgggcggggtg
aaagtggcaaaaagcctcgaggaagtccgtacatacgccagcgaattgctcggcaaagtg
ctcgtcacccatcaaaccggcccggaaggaaaagaagtgaaacggctgttgattgaagaa
gggtgcgacatccaaaaagaatactacatcggccttgtcgtcgaccgcgccacctcgcgc
gtcgtgttaatggggtcggaagaaggcggcacggaaatcgaagaagtcgcggcgaaaacg
ccggagaaaattttcaaagagtacattgacccggccgtcgggctgcaggcgttccaagcg
cgccgcttggcgttcaacatcaacattccgaagcatctcgtcaaccaagcggtcaaattt
atgatgggcttgtaccaagtgtttgtcgacaaagactgctcgatcgccgaaatcaacccg
cttgtcgtcaccggcgacggcaaggtgatggcgcttgacgcgaagctgaactttgattcg
aacgcgttgtaccgccacccggacgtgctcgaataccgcgatttggacgaagaagatccg
aaagaggttgaagcatcgaaatacgacttgaactacatcgcccttgacggcaacatcggc
tgcatggtcaacggcgccggcttggcgatggcgacgatggacatcatcaaatattacggc
ggcgagccggccaacttcctcgatgtcggcggcggcgccagcgaggaaaaagtgacggaa
gcgttcaaaatcattttgtcggacccgaacgtgaaaggcattttcgtcaacattttcggc
ggcattatgaaatgcgacgtcatcgcgagcggcatcgtcgcagcgacgaagcaagtcggt
ttgacgcttccgcttgtcgtccggcttgaaggaacgaacgttgagcttgggaaaaagatt
ttgcaagagtcaggcttaaacattattgcggccgaatcgatggcggacggagcacaaaaa
atcgtcgagctagtacgttaa

DBGET integrated database retrieval system