KEGG   Geobacillus thermoleovorans: GTCCBUS3UF5_14470Help
Entry
GTCCBUS3UF5_14470 CDS       T01676                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase 2
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
gte  Geobacillus thermoleovorans
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gte00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    GTCCBUS3UF5_14470
Enzymes [BR:gte01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     GTCCBUS3UF5_14470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1333261..1334418
Genome map
AA seq 385 aa AA seqDB search
MKRLKYISILGASGSIGTQTLDVIRAHPDEFRLAAASVGKNIEAARRLIAEFSPSLVAVA
DRDAYEVLYREYRGRTTIVYGEEGLIEAAVCPQADVVVTAVVGSVGLVPTLKAIEAGKAI
ALANKETLVVAGHLVMAAAKRRGVPLLPVDSEHSAIFQCLQGERMEQVDKLILTASGGSF
RDKTRRELAHVTVEEALRHPNWSMGAKITIDSATMMNKGFEVIEAHWLFGLPYERIEVVL
HRESIIHSLVQFRDTSVLAQLGTPDMRVPIQYALAYPKRLPLPSAKPLDLISLGALHFAP
VDFDRYRCLRLAYEAGKRGGSLPTVLNAANEEAVAAFLAGRIPFLAIEEWIERALERHRP
VSDPQLEDIREIDADARAYVRSLLT
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacgattgaaatatattagtatattaggggcgagcggatcgatcggcacacagacg
ctcgatgtcatccgcgcccatccggacgaattccgcttggccgccgcatcggtcgggaaa
aatatcgaggcggcgaggcggctgatcgctgaattttccccaagtcttgtcgccgtcgct
gaccgtgatgcgtatgaagttctttatcgcgagtaccgcgggcggacgacgatcgtgtac
ggagaggaaggattgattgaagcagccgtttgcccacaagccgatgttgtcgtcaccgct
gtcgtcggcagcgtcggccttgtgccgacgctgaaggcgattgaagcgggaaaagcgatc
gccctcgccaacaaagagacgctcgttgtcgccggacatctcgtcatggctgcagccaag
cggcgcggcgtgccgctgttgccagttgacagtgaacattccgccatttttcaatgtctg
caaggggaaaggatggagcaagtcgacaaactcattctgaccgcatccggcggcagcttc
cgcgacaagacgcgccgagagctcgctcatgtgacggttgaggaggcgcttcgccatccg
aactggtcgatgggggcaaaaattacgattgattcggcgaccatgatgaataaaggattt
gaggtcattgaggctcattggctgttcgggctgccgtatgagcggattgaggttgttttg
catcgagaaagcatcatccattcgctcgttcagttccgtgacacaagtgtattggcgcag
cttggaacgccggatatgcgcgttccgatccaatacgcgcttgcgtatccaaagcggttg
ccgctcccatccgccaagccgcttgatttaatctcgcttggggcgctccatttcgccccg
gttgatttcgaccgctatcgctgtttgcgtctcgcctatgaggctggcaagcgcggcggc
tcgctgccgacggtgttgaatgcggccaatgaggaggcggtggcggcgtttttagccggg
cgcattccgtttttggccatcgaggagtggattgaacgcgcgctcgagcgccatcggcca
gtgagcgatccgcagcttgaggacattcgtgaaatcgatgcggacgcgcgcgcctacgtc
cgctcactactaacataa

DBGET integrated database retrieval system