KEGG   Geobacillus thermoleovorans: GTCCBUS3UF5_15620Help
Entry
GTCCBUS3UF5_15620 CDS       T01676                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
gte  Geobacillus thermoleovorans
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gte00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    GTCCBUS3UF5_15620
Enzymes [BR:gte01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     GTCCBUS3UF5_15620
Exosome [BR:gte04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GTCCBUS3UF5_15620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1444353..1445843
Genome map
AA seq 496 aa AA seqDB search
MNQYILAIDQGTTSSRAILFNQKGEIVHMAQKEFTQYFPQPGWVEHNANEIWGSVLAVIA
SVLSEAQVKPEQVAAIGITNQRETTVVWEKDTGNPIYNAIVWQSRQTAGICDELKAKGYD
PLFREKTGLLIDAYFSGTKVKWILDHVEGARERAERGELLFGTIDTWLIWKLSGGRAHVT
DYSNASRTLMFNIHTLEWDDELLAILNVPKAMLPEVRPSSEVYAKTVPHHFFGVEVPIAG
AAGDQQAALFGQACFTEGMAKNTYGTGCFMLMNTGEKAVQSKHGLLTTIAWGIDGKVEYA
LEGSIFVAGSAIQWLRDGLRMIKTAADSEAYAEKVESTDGVYVVPAFVGLGTPYWDSEVR
GAVFGLTRGTTKEHFIRATLESLAYQTKDVLAAMEADSGISLTTLRVDGGAVKNNFLMQF
QSDLLAVPVERPVVNETTALGAAYLAGLAVGYWNSRDDIAAQWQLERRFEPKMDDDKRTM
LYDGWKKAVRAAMAFK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaatacattttagccatcgaccaaggcacaacgagttcgcgcgcgattttgttc
aatcaaaagggcgaaatcgtccatatggcgcaaaaagagtttacgcaatattttccgcag
cccggctgggtcgagcacaacgccaatgaaatttggggatcggtgcttgcggtcattgcc
agcgtcttgtccgaggcgcaagtgaagccggaacaagtggcggcgatcggcattacgaac
cagcgggaaacgacggttgtgtgggagaaagacaccggcaacccgatttacaacgccatc
gtctggcagtcgcggcagacggccggcatttgcgatgaactgaaagcgaaagggtatgac
ccgctattccgcgaaaaaaccggcttgcttattgacgcctatttttccgggacaaaagtg
aaatggattttggaccatgtcgagggggcgcgcgaacgggcggagcgaggagagctgctc
tttggcacgattgatacgtggctcatttggaagctgtccggcggccgcgcccatgtaacc
gattactcgaacgcgtcgcgcacattaatgtttaacattcatacgctcgagtgggatgac
gagctgcttgcgattttaaacgtgccaaaggcgatgcttcctgaggtgcgcccgtcctcg
gaagtatacgcgaaaacggttccgcatcatttcttcggcgtggaggtgccgatcgcggga
gccgcgggcgaccagcaggcggctttgttcggccaggcgtgctttacggaagggatggcg
aaaaatacgtacggcaccggctgctttatgctgatgaatacgggggaaaaagcggtgcaa
tcgaaacacgggctgctcacaacgatcgcctggggaattgacggcaaggttgaatacgcc
cttgaaggcagcattttcgtcgccggttcggccattcaatggctgcgcgacggcttgcgg
atgatcaaaacggcggctgacagcgaagcgtacgctgaaaaagtcgagtcgaccgacggg
gtgtatgtcgtaccggcgttcgtcgggcttggcacgccgtattgggacagcgaggtgcgc
ggggcggtgtttggcctcacgcgcggcacaacgaaagagcatttcatccgggccactttg
gaatcgctcgcttaccagacaaaagatgtgctcgccgccatggaagccgattccggcatc
tcgctgaccacgttgcgcgttgacggcggggcggtgaaaaacaatttccttatgcaattc
cagagcgatttgcttgccgttccggtcgaacgtccggttgtgaatgaaacgacggccttg
ggtgcggcgtatttggccgggctggcggtcggctactggaacagccgagatgacatcgcc
gcccaatggcagcttgagcgccggtttgagccgaagatggatgacgacaagcgaacgatg
ctctacgatggctggaaaaaagcggtgcgggcggcgatggcgtttaaataa

DBGET integrated database retrieval system