KEGG   Geobacillus thermoleovorans: GTCCBUS3UF5_1640Help
Entry
GTCCBUS3UF5_1640  CDS       T01676                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
gte  Geobacillus thermoleovorans
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gte00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GTCCBUS3UF5_1640
  Amino acid metabolism
   00330 Arginine and proline metabolism
    GTCCBUS3UF5_1640
Enzymes [BR:gte01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     GTCCBUS3UF5_1640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
161766..162665
Genome map
AA seq 299 aa AA seqDB search
MKPISIIGVPMDLGQTRRGVDMGPSAMRYAGVIERLERLHYDIEDLGDIPIGKAERLHEQ
GDSRLRNLKAVAEANEKLAAAVDQVVQRGRFPLVLGGDHSIAIGTLAGVAKHYERLGVIW
YDAHGDVNTAETSPSGNIHGMPLAASLGFGHPALTQIGGYSPKIKPEHVVLIGVRSLDEG
EKKFIREKGIKIYTMHEVDRLGMTRVMEETIAYLKERTDGVHLSLDLDGLDPSDAPGVGT
PVIGGLTYRESHLAMEMLAEAQIITSAEFVEVNPILDERNKTASVAVALMGSLFGEKLM
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaagccaatttcaattatcggggttccgatggatttagggcagacacgccgcggcgtt
gatatggggccgagcgcaatgcgttatgcaggcgtcatcgaacgtctggaacgtcttcat
tacgatattgaagatttgggagatattccgattggaaaagcagagcggttgcacgagcaa
ggagattcacggttgcgcaatttgaaagcggttgcggaggcgaatgagaaactcgcggcg
gcggttgaccaagtcgttcagcgggggcgcttcccacttgtgctgggcggcgaccatagc
atcgccattggcacgctcgccggggtggcgaaacattatgagcggcttggagtgatctgg
tatgacgcgcatggcgacgtcaacaccgcggaaacgtcgccgtctggaaacattcatggc
atgccgctggcggcgagcctcgggtttggccatccggcgctgacgcaaatcggcggatac
agccccaaaatcaagccggaacatgtcgtgttgatcggcgtccgttcccttgatgaaggg
gagaagaagtttattcgcgaaaaaggaatcaaaatttacacgatgcatgaggttgatcgg
ctcggaatgacaagggtgatggaagaaacgatcgcctatttaaaagaacgaacggatggc
gttcatttgtcgcttgacttggatggccttgacccaagcgacgcaccgggagtcggaacg
cctgtcattggaggattgacataccgcgaaagccatttggcgatggagatgctggccgag
gcacaaatcatcacttcagcggaatttgtcgaagtgaacccgatcttggatgagcggaac
aaaacagcatcagtggctgtagcgctgatggggtcgttgtttggtgaaaaactcatgtaa

DBGET integrated database retrieval system