KEGG   Geobacillus thermoleovorans: GTCCBUS3UF5_16570Help
Entry
GTCCBUS3UF5_16570 CDS       T01676                                 

Definition
transcriptional regulator, PucR
Orthology
K09684  
purine catabolism regulatory protein
Organism
gte  Geobacillus thermoleovorans
Brite
Transcription factors [BR:gte03000]
 Prokaryotic Type
  Other transcription factors
   Others
    GTCCBUS3UF5_16570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1541211..1542839
Genome map
AA seq 542 aa AA seqDB search
MKTPTLTVSDILKRKHFEHVEVVAGHNGLNRTVKWVHVVEVAKIHHLLNGKELILSTGVG
WKENEELFRSFVEQLINCDASGLCIEIGMHTPSVPQEVIDLANAHHFPIILFLKEVPFVE
ITQDIHTYLINQHYEIISGLESYSQQLNKKLLSMDHYSEILKLLHHYSGHQVVFKINGRE
VEIFPKYSKTFKEEQLIVDDNAASKKRVATQPIQFLGNEYAELSIVSTGKEISEFDLLIL
DRTATALAQHLLRDLYVDEKKRVEENEWLKSWLEGEHSIENVFSYLAEYGADPNPKGGTV
LVVRFKSSMKQCSNLDMIYFKMLCRTIFEQQGFSTFPVDFHSSIVFIMINNREMKTWKSR
MKIGLNSLLESDYIQKKKLPQFVVGVGKFIENVSHMDKSYRTALETIKIQHHLGGRANSC
FYEDLHIYRIISLIHKYNDLYEVVMEYLEPVLQYDEKYNGNLLETLKVYLACNGSKKETA
QRLFVVRQTLYHRIQKLESLLGEDFMNPEKRLAIEFMIKAYEYLQLQSMENKYVQHDRLR
RL
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgaagactcctacattaacggtttctgatattctaaagcggaaacattttgaacatgtt
gaagtggttgcagggcataatgggctcaaccgcactgtaaaatgggtgcatgttgtcgaa
gttgcgaaaatccatcatctgttaaacggaaaagagctgattttatctactggggtagga
tggaaggaaaatgaggaactgtttcgatcgtttgtagaacagcttatcaactgtgacgct
tcgggattatgtattgaaatcggtatgcatactccttctgttccgcaagaagtaatcgat
ttagcgaatgcgcatcactttccgatcattctctttcttaaagaagtgcctttcgttgag
atcacccaagacatccacacttatttaattaaccaacactatgaaatcatctccggacta
gaatcatattcacagcaattaaacaaaaaattactttcaatggatcattatagtgaaatt
ttaaaactattgcaccactattcgggacatcaagtagtttttaaaataaacggcagagag
gtggagatatttcctaaatacagcaaaacatttaaggaagaacagttgatagttgacgac
aacgcagcttccaagaaaagagtggccacccaaccgatccaatttcttgggaatgaatat
gccgagctatccattgtgtcaaccggaaaggaaatcagcgaatttgatctgctgattttg
gatcgtacggcaactgcgctggcacagcatctgcttcgtgatttgtatgtcgatgaaaaa
aagagagtagaagaaaatgagtggttgaaaagctggctagagggagagcattccattgaa
aatgtgtttagttatttggctgagtatggggcagacccaaatccaaaaggagggacagtg
cttgttgtccgttttaaatcttcaatgaagcaatgctcgaatttagacatgatttacttt
aaaatgctatgccggacgatttttgaacaacaaggtttttcaacatttcctgtcgatttt
cacagcagcatcgtatttattatgatcaataacagggaaatgaaaacatggaaaagtcga
atgaaaataggactgaattctttgcttgaatcggattatattcaaaagaagaaattacct
caatttgttgtcggggtcggaaaatttatcgaaaatgtttctcatatggacaaaagttat
cggacagctttagagacgatcaaaattcaacatcatcttggcggcagggccaatagctgt
ttttatgaggatttgcatatttatcgaattatttcccttattcataaatacaatgatttg
tatgaagttgtcatggaatacttagagcctgttcttcaatacgatgaaaaatataatgga
aacttgttggaaacgttaaaggtatatttggcgtgtaacggttcaaaaaaagaaaccgca
caaagactatttgtcgttaggcaaacgctgtatcatcgaatccaaaaactagaatcgctt
ttaggagaggattttatgaatccggaaaagcggctcgctattgagtttatgatcaaggca
tatgaatatttacaattgcaaagtatggaaaacaaatatgtacagcatgatcggttgcga
agattgtaa

DBGET integrated database retrieval system