KEGG   Geobacillus thermoleovorans CCB_US3_UF5: GTCCBUS3UF5_17690Help
Entry
GTCCBUS3UF5_17690 CDS       T01676                                 

Definition
(GenBank) Malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
gte  Geobacillus thermoleovorans CCB_US3_UF5
Pathway
gte00620  Pyruvate metabolism
gte00630  Glyoxylate and dicarboxylate metabolism
gte01100  Metabolic pathways
gte01110  Biosynthesis of secondary metabolites
gte01120  Microbial metabolism in diverse environments
gte01200  Carbon metabolism
Module
gte_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:gte00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    GTCCBUS3UF5_17690
   00630 Glyoxylate and dicarboxylate metabolism
    GTCCBUS3UF5_17690
Enzymes [BR:gte01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     GTCCBUS3UF5_17690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: AEV19079
UniProt: G8N4L5
Position
1647188..1649371
Genome map
AA seq 727 aa AA seqDB search
MGEYVQKGNIQVAKVLYDFVNEELLPNSGLDQDKFWSDFGALISDLTPRNKELLARRDEI
QEKLNEWHKAHRGRFDFNEYKAFLTDIGYLEPEVEDFEITTDNVDDEIAVQAGPQLVVPL
TNARYALNAANARWGSLYDALYGTDAISEEDGAERGSSYNPVRGAKVIAYGRQFLDEAVP
LAQYSHKDAVQYAIVDGQLVVTTEGGATTGLKEPKKFVGFQGDPQHPTAVLLKNNGLHIE
IQIDREHAVGKTDQAGVKDIVLEAAVTTIMDGEDSVAAVDAEDKVLVYRNLFGLVKGDLT
ATFEKNGKIMTRSLNPDRVYKTPDGGELVLPGRSLMFVRNVGHLMTNNAILHANGEEVHE
GIMDAVITSLIMKHSLIGNTRYLNSRKGSIYIVKPKMHGSAEVAFANELFDRVEDMLGLE
RNTIKIGVMDEERRTSLNLKNCIYQVRDRIIFINTGFLDRTGDEIHTSMEAGPMLRKNEM
KSSTWLQAYEKSNVAVGLAAGFRGRAQIGKGMWAMPDLMAEMLKQKGAQLKAGANTAWVP
SPTAATLHALHYHQVNVSAVQSELANDRNDYRDDMLQIPVVDHPQWTAEEIQEELDNNCQ
SILGYVVRWIDQGIGCSKVPDIHNVGLMEDRATLRISSQILANWLHHGICTKEQVLETLK
RMAKVVDEQNAGDPNYRPMAPNYDDSVAFQAACDLIFRGYEQPNGYTEPILHRRRQEAKA
KFAAIQQ
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgggcgaatacgtacaaaaagggaacatccaagtcgccaaagtgttgtacgactttgtc
aacgaggagcttctgccgaacagcgggttggatcaagacaagttttggagcgatttcggc
gcgctcatttccgacttgacgccgcgcaacaaagaattgctcgcccgccgcgacgaaatt
caagaaaaattgaatgagtggcataaagcgcatcgcggccgctttgattttaacgaatat
aaagcatttttgacagacatcggctatttggagccggaagtcgaggactttgagattacg
accgacaatgtcgatgatgaaattgccgtgcaagccgggccgcagctcgtcgttccgttg
acgaacgcccgctatgcattaaacgctgccaacgcccgttggggcagcctgtacgacgcg
ctgtacggcaccgatgccatcagcgaagaagacggcgccgagcgcggttcgtcgtacaac
ccggtgcgcggggcgaaagtcatcgcctacgggcggcagtttttagatgaagcggtgccg
ctggcgcaatattcccataaagacgctgtccagtacgccattgttgatggccagcttgtc
gtgacgacagaaggcggggcgacgacggggctgaaagagccgaaaaaattcgtcggcttc
caaggcgacccgcaacatccgacagcggtgttgctgaagaacaatggccttcacattgaa
attcaaatcgaccgcgagcatgcggtcggaaaaacggatcaagccggggtcaaagacatt
gtcctagaagcggccgtgacaacgatcatggacggtgaagattcggtggcggccgttgac
gccgaagacaaagtgctcgtttaccgcaacttgtttggtctcgttaaaggcgatttgaca
gcgacatttgagaaaaacggcaaaatcatgacgcgctccctgaacccggatcgcgtatac
aaaacgccggatggcggggagctcgtgctgccgggccgttcgctcatgttcgtgcgcaac
gtcgggcacttaatgacgaacaacgcgatcttgcatgcgaatggcgaggaagtgcatgaa
gggatcatggacgccgtcattacaagcttgattatgaaacattcgctcatcggcaataca
cgctacttgaattcgcgcaaaggttccatctacatcgtcaagccgaaaatgcacggatcg
gcggaagtggcgtttgccaacgagctgtttgaccgtgtcgaagatatgctcggccttgag
cggaatacgattaaaatcggcgtgatggacgaggagcgccgcacgtcgctcaacttgaaa
aactgcatctaccaagtgcgcgaccgcatcatttttatcaacaccggcttcctcgaccgg
accggagacgaaattcatacgtcgatggaagcggggccgatgctgcgcaaaaacgagatg
aaatcatcgacttggctgcaggcgtatgaaaaatcgaacgtcgccgttgggcttgccgcc
ggcttccgcggccgggcgcaaatcggcaaaggaatgtgggcgatgccggatttgatggca
gaaatgctgaagcaaaaaggagcgcagctcaaagcaggcgccaatacggcatgggtgccg
tcgccgacagcggccacgctccatgcgcttcattaccatcaagtgaacgtctccgctgtg
caaagcgaactggcgaacgatcggaacgattatcgcgacgacatgttgcaaatcccggtc
gttgaccatccgcaatggacagcggaagagattcaagaagagctcgacaacaactgccaa
agcattttaggctatgtcgtccgctggatcgaccaagggatcggctgctcgaaagtgccg
gacattcacaacgtcggactgatggaagaccgggcgacgcttcgcatctcgagccaaatt
ctcgccaactggctccatcatggcatttgcacgaaagagcaagtgcttgagacgctcaag
cggatggcgaaagtcgtcgacgaacaaaacgccggcgatccgaactatcgtccgatggcg
ccgaattacgatgattcggtggcgttccaagcggcgtgcgatctcattttccgcggctat
gaacagccaaacggctataccgagccgattttgcaccgccgccgtcaagaagcaaaagcg
aaatttgccgccattcagcaataa

DBGET integrated database retrieval system