KEGG   Geobacillus thermoleovorans: GTCCBUS3UF5_20510Help
Entry
GTCCBUS3UF5_20510 CDS       T01676                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
gte  Geobacillus thermoleovorans
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:gte00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GTCCBUS3UF5_20510
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GTCCBUS3UF5_20510
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    GTCCBUS3UF5_20510
Enzymes [BR:gte01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     GTCCBUS3UF5_20510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1888960..1890213)
Genome map
AA seq 417 aa AA seqDB search
MRMKQMERRSQTMSFSYVSHLYCPKCERTYDVDQIHQLCECGSPLLVAYDLEAMRQKVKR
DVLREREANLWRYHELLPVKHPEHIVSLGEGMTPLVPMPRLGREIGIEALYMKDEGVIPT
GTFKARGAAVGISKAKELGVKQLAMPTNGNAGAAWSLYAARAGIQATVVMPVEAPELTRK
ECAIAGAELYFVNGLISDAGQIVAKAIREYGWYDASTLKEPYRIEGKKTMGLEIAEQFSW
QLPDVILYPTGGGVGLIGIYKAIKELQALGWVDGRMPRLVAVQAEHCAPIVKAWKEKKRE
SEFWPNAHTVAFGINVPKALGDFLVLEAVYETNGCAIAISDEAILAQQQMVAKLEGAFIC
PEGAAAFAAARTLRESGWIRDGEKVVVLNTGTGLKYADLVQVAPPVLEPGDSLPMRE
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
gtgcggatgaaacaaatggaaaggagaagccaaaccatgtcattcagctacgtgtctcat
ctgtattgtccgaagtgtgaacgtacatacgatgtcgaccaaatccatcaactttgcgaa
tgcggttcgccgcttcttgtcgcttacgacttggaggcgatgcgccaaaaagtcaagagg
gatgtgctgagggaacgtgaagcgaatttatggcgttatcatgagttgctgccggtaaag
catcctgaacatatcgtgtcgctcggcgaagggatgacgccgcttgtgccgatgccgcgc
ttagggcgggaaatcggcattgaagcgctctacatgaaagacgaaggggttattccgaca
gggacgtttaaagcccgcggcgcggcggttgggatttctaaagcaaaggaattgggcgtc
aaacagctcgcgatgccgacaaacggcaacgcgggagcggcgtggtcgctgtacgcggcg
cgggcgggcattcaggcgacggtcgtcatgccggttgaggcgccggaactgacgcgaaag
gaatgcgccatcgctggggcggaattgtatttcgtcaacggcctcattagcgatgccggg
caaatcgtcgccaaagcgatccgcgaatacggctggtacgatgcgtcgacgttgaaagaa
ccgtaccggattgaagggaagaaaacgatggggctggagatcgccgagcagttctcttgg
cagctcccggatgtcattttgtatccgaccggcggcggcgtcgggttgatcggcatttac
aaggcgatcaaagaactgcaggcgctcggctgggtggacggccgcatgccgcggctggtc
gctgtgcaggccgagcattgcgcgccgatcgtcaaggcgtggaaggagaaaaaacgtgaa
tcggagttttggccgaacgcccatacagtggcgtttggcatcaatgtgccgaaagcgctt
ggcgactttcttgttcttgaggcggtgtatgagacgaacggctgcgccattgcgatcagc
gatgaggcgattttggcccaacagcagatggtggcgaaactggaaggggcgttcatttgc
ccggaaggagcggcggcgtttgcggcggcacgaacgttgcgcgagagcggttggattcgt
gatggggagaaggtcgtcgtgctcaacacggggacgggattgaaatacgccgatttggtt
caagtcgccccaccggtgctcgaaccgggagattcgcttccgatgcgggaataa

DBGET integrated database retrieval system