KEGG   Geobacillus thermoleovorans CCB_US3_UF5: GTCCBUS3UF5_20700Help
Entry
GTCCBUS3UF5_20700 CDS       T01676                                 

Definition
(GenBank) hypothetical protein
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
gte  Geobacillus thermoleovorans CCB_US3_UF5
Pathway
gte00670  One carbon pool by folate
gte00790  Folate biosynthesis
gte01100  Metabolic pathways
Module
gte_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:gte00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    GTCCBUS3UF5_20700
   00670 One carbon pool by folate
    GTCCBUS3UF5_20700
Enzymes [BR:gte01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     GTCCBUS3UF5_20700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: AEV19378
UniProt: G8N770
Position
complement(1905023..1905517)
Genome map
AA seq 164 aa AA seqDB search
MISHIVAMDENRVIGKDNRLPWHLPADLAYFKRVTMGHAIVMGRKTFEAIGRPLPGRDNV
VVTRNRSFRPEGCLVLHSLEEVKQWIASRADEVFIIGGAELFRATMPIVDRLYVTKIFAS
FPGDTFYPPISDDEWEIVSYTPGGKDEKNPYEHAFIIYERKKAK
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgatttcgcacattgtggcaatggatgaaaaccgggtgatcggcaaagacaaccgcttg
ccttggcatttgccggccgatttggcgtattttaaacgggtgacaatgggccatgccatc
gtgatggggcgcaagacgtttgaagcgatcggccggccgcttcccggccgcgataacgtc
gttgtcacgcgcaaccgctcgtttcgtccggaaggctgccttgtgcttcattcgctcgag
gaagtcaagcaatggatcgcatcgcgcgctgatgaagtgtttatcatcggcggggccgaa
ctgtttcgggcgacgatgccgattgtcgaccggctgtatgtgacaaaaatttttgcttcc
ttccccggcgatacgttttatccgcccatttctgacgatgaatgggaaatcgtttcctat
acgccaggagggaaagatgaaaagaatccgtatgaacacgcctttatcatttatgagcgg
aaaaaggcgaaatag

DBGET integrated database retrieval system