KEGG   Geobacillus thermoleovorans: GTCCBUS3UF5_21670Help
Entry
GTCCBUS3UF5_21670 CDS       T01676                                 

Definition
6-phospho-beta-glucosidase gmuD
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
gte  Geobacillus thermoleovorans
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:gte00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GTCCBUS3UF5_21670
Enzymes [BR:gte01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     GTCCBUS3UF5_21670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1990463..1991875)
Genome map
AA seq 470 aa AA seqDB search
MEQRSKQPITYRFPAGFWWGSATSATQIEGAANEGGKGKNIWDHWYEQEPHRFFQGVGPE
VTSDFYHRYKEDIALMKEIGHNSFRFSISWSRLIPDGVGEVNSEAVRFYNAVIDELLANG
IEPFVNLYHFDMPLVMQNIGGWENREVIDAYARYASLCFQLFGDRVKTWFTHNEPIVPVE
GGYLYDFHYPNVVDFRRAVQVAYHTMIAHAKAVAAFRRAAIQGGKIGIILNLTPSYPRSQ
HPADVKAAHIADLLFNRSFLDPAVKGEYPQDLIELLAEHRFLPVMEVGDRELIKENTIDL
LGINYYQPRRVKAKEHLPNPDAPFLPERFFDYYAMPGRKMNPYRGWEIYEKGIYDILINI
KEKYGNIECFISENGMGVEGEERFRDESGMIHDDYRIEFIQEHLKWVHRAIEEGTNVKGY
HIWTFMDNWSWTNAYKNRYGLVAVDLENGLKRTIKKSGYWFKSLAENNGF
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggaacaacgatcaaagcaaccaatcacgtatcgctttcctgccggattttggtgggga
agtgcgacatcagcgacgcaaatcgaaggagcggcaaacgaaggggggaaagggaagaac
atttgggatcattggtatgagcaagagcctcatcgcttttttcaaggcgtcggcccagaa
gtgacatccgatttttatcatcgttacaaagaagatattgcgttaatgaaggagatcggc
cataattcattccggttttccatttcatggtcgcgcttgattccggatggggttggtgag
gtcaactcggaggcggtgcggttttacaatgcggtcatcgatgaattgctggcgaatggg
attgaaccgtttgtgaatttgtaccattttgatatgccgctggtgatgcaaaacattggc
ggatgggaaaatcgcgaggttatcgatgcttatgcccgctatgccagcctttgctttcaa
ttgtttggcgatcgggtgaaaacatggtttacgcacaatgaacccattgtccctgtagaa
ggcgggtatttgtacgatttccactatccgaatgtagttgacttccgccgcgccgtgcag
gtggcttaccatacgatgatcgcccatgccaaagcggttgccgccttccgcagggcggcg
atacagggtggaaagatcggcattattttgaatttaacgccgtcttatccgcgcagccaa
catccggctgatgtgaaagcagcgcatatcgctgatttgttgtttaaccgcagtttttta
gatcctgcggtaaaaggagaatacccgcaagatttaatcgagttgttggctgaacaccgt
tttttgccggtgatggaagtcggtgaccgcgaactcatcaaagaaaatacgatcgatttg
cttgggatcaactactatcaaccgcgacgtgtgaaggcgaaagaacatctgcccaacccg
gacgccccgtttttgcctgaacggtttttcgattactatgccatgccggggcggaaaatg
aatccgtatcgcggttgggaaatttatgaaaaaggtatttatgatattttaattaatata
aaagaaaaatatggaaacattgagtgctttatttctgaaaacgggatgggtgttgaagga
gaagaacggttccgtgatgaaagcggcatgattcacgatgactaccggattgaattcatt
caagagcatttaaaatgggtgcatcgcgcgattgaagaaggaacaaatgttaaaggttac
catatttggacgtttatggacaattggtcgtggaccaatgcctataaaaatcggtatggg
ctcgtggcagtcgacttggagaacggtttgaaacgaaccattaaaaaaagtggttattgg
tttaaatcgttggcagaaaacaacggattttaa

DBGET integrated database retrieval system