KEGG   Geobacillus thermoleovorans: GTCCBUS3UF5_220Help
Entry
GTCCBUS3UF5_220   CDS       T01676                                 

Definition
hypothetical protein
Orthology
K06187  
recombination protein RecR
Organism
gte  Geobacillus thermoleovorans
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:gte03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
27757..28353
Genome map
AA seq 198 aa AA seqDB search
MHYPEPLSKLIDSFMKLPGIGPKTAARLAFHVLAMKEDTVLEFAKALVDVKRHIHYCTIC
GHITDTDPCYICKDERRDRTTICVVQDPKDVIAMERMKEYNGLYHVLHGAISPMEGIGPE
DIKIAELLTRLQDETVQEVILATDPNIEGEATAMYISRLLKPTGIKVTRIAHGLPVGGDL
EYADEVTLSKALEGRREL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcattatccagaaccgctatcgaagttgattgacagttttatgaaactgcccggcatc
ggcccgaaaacggctgcccgccttgcatttcatgtgctggcgatgaaagaagacaccgtg
cttgagtttgccaaagcgctcgttgatgtcaagcggcatattcattattgcacgatttgc
ggacatattacagatacagacccttgctatatctgcaaagacgagcggcgcgaccggacg
acgatttgcgttgttcaggatccgaaagatgtcatcgccatggagaggatgaaagaatac
aatggcctgtaccacgtgttgcacggggccatctcgccgatggaaggcatcggaccggaa
gatattaaaatcgccgagctgctcacgcgattgcaggatgagacggtccaagaggtgatt
ttagcgaccgacccgaacatcgagggagaggcaacggcgatgtacatctcccgcctgttg
aagccgacaggaatcaaagtcacccgcatcgcccatggcttgccggtcggcggcgacttg
gagtatgcggacgaagtgacgttatcaaaggcgttggaagggcgccgtgagctatag

DBGET integrated database retrieval system