KEGG   Geobacillus thermoleovorans: GTCCBUS3UF5_220Help
Entry
GTCCBUS3UF5_220   CDS       T01676                                 

Definition
hypothetical protein
Orthology
K06187  
recombination protein RecR
Organism
gte  Geobacillus thermoleovorans
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:gte00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    GTCCBUS3UF5_220
DNA repair and recombination proteins [BR:gte03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      GTCCBUS3UF5_220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
27757..28353
Genome map
AA seq 198 aa AA seqDB search
MHYPEPLSKLIDSFMKLPGIGPKTAARLAFHVLAMKEDTVLEFAKALVDVKRHIHYCTIC
GHITDTDPCYICKDERRDRTTICVVQDPKDVIAMERMKEYNGLYHVLHGAISPMEGIGPE
DIKIAELLTRLQDETVQEVILATDPNIEGEATAMYISRLLKPTGIKVTRIAHGLPVGGDL
EYADEVTLSKALEGRREL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcattatccagaaccgctatcgaagttgattgacagttttatgaaactgcccggcatc
ggcccgaaaacggctgcccgccttgcatttcatgtgctggcgatgaaagaagacaccgtg
cttgagtttgccaaagcgctcgttgatgtcaagcggcatattcattattgcacgatttgc
ggacatattacagatacagacccttgctatatctgcaaagacgagcggcgcgaccggacg
acgatttgcgttgttcaggatccgaaagatgtcatcgccatggagaggatgaaagaatac
aatggcctgtaccacgtgttgcacggggccatctcgccgatggaaggcatcggaccggaa
gatattaaaatcgccgagctgctcacgcgattgcaggatgagacggtccaagaggtgatt
ttagcgaccgacccgaacatcgagggagaggcaacggcgatgtacatctcccgcctgttg
aagccgacaggaatcaaagtcacccgcatcgcccatggcttgccggtcggcggcgacttg
gagtatgcggacgaagtgacgttatcaaaggcgttggaagggcgccgtgagctatag

DBGET integrated database retrieval system