KEGG   Geobacillus thermoleovorans: GTCCBUS3UF5_22690Help
Entry
GTCCBUS3UF5_22690 CDS       T01676                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
gte  Geobacillus thermoleovorans
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:gte00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:gte00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2091846..2092619)
Genome map
AA seq 257 aa AA seqDB search
MAHRTALVTGAARGIGYEVAKTLATNGVNVVLADLKQEEVEQAAESLRQLGCEAVGVKCD
VTAEEEVKQTIHEAVKRWERLDIVVNNAGLQYVANIEDFPTEKFEQLIRVMLVGPFLAIK
HAFPLMKEQRYGRIINMASINGLIGFAGKAAYNSAKHGVIGLTKVAALEGAPYGITVNAL
CPGYVDTELVRNQLADLAATRKVPLEKVLEEVIYPLVPQRRLLSVEEVAHYVLFLAGEQA
KGITGQAVVIDGGYTAQ
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggcgcatcgcacagccctcgtcaccggagcggcgcgggggatcggttatgaagtagcg
aaaacgttggcaaccaacggcgtgaacgtcgtgcttgccgacttgaagcaggaagaggtg
gaacaggcggcagagtcgttgcggcagctaggctgcgaggccgtcggcgtcaagtgtgat
gtgacggcggaagaagaggtgaaacaaacgatccatgaagcggtcaaacggtgggagcgt
ctcgatattgtcgtgaacaacgccggtttgcaatatgtcgccaatattgaagactttccg
accgagaagttcgagcagttgatccgcgtcatgctcgtcggcccgtttttggccattaag
catgcgtttccgctgatgaaggagcagcgctacggccgcattatcaacatggcgtcgatt
aacggattgatcgggtttgccggaaaagccgcctacaacagcgcaaaacacggggtgatc
ggcttaacgaaagtggcggcgctagaaggggcaccgtacggcattacggtgaacgcactt
tgtccggggtatgtcgacacagaactcgtccgcaatcagctcgctgatttggcggcgacg
agaaaggtgccgcttgagaaggtgctcgaggaagtgatttacccgctcgtgccgcagcgg
cggctcttgtccgttgaagaagtcgcccattatgttctctttttggcaggcgaacaagcg
aaaggaatcaccggccaggcggtcgtgatcgatggcgggtatacggcgcaatga

DBGET integrated database retrieval system