KEGG   Geobacillus thermoleovorans CCB_US3_UF5: GTCCBUS3UF5_23130Help
Entry
GTCCBUS3UF5_23130 CDS       T01676                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
gte  Geobacillus thermoleovorans CCB_US3_UF5
Pathway
gte00071  Fatty acid degradation
gte00280  Valine, leucine and isoleucine degradation
gte00281  Geraniol degradation
gte00310  Lysine degradation
gte00360  Phenylalanine metabolism
gte00362  Benzoate degradation
gte00380  Tryptophan metabolism
gte00410  beta-Alanine metabolism
gte00627  Aminobenzoate degradation
gte00640  Propanoate metabolism
gte00650  Butanoate metabolism
gte00903  Limonene and pinene degradation
gte00930  Caprolactam degradation
gte01100  Metabolic pathways
gte01110  Biosynthesis of secondary metabolites
gte01120  Microbial metabolism in diverse environments
gte01130  Biosynthesis of antibiotics
gte01212  Fatty acid metabolism
Module
gte_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:gte00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    GTCCBUS3UF5_23130
   00650 Butanoate metabolism
    GTCCBUS3UF5_23130
  Lipid metabolism
   00071 Fatty acid degradation
    GTCCBUS3UF5_23130
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GTCCBUS3UF5_23130
   00310 Lysine degradation
    GTCCBUS3UF5_23130
   00360 Phenylalanine metabolism
    GTCCBUS3UF5_23130
   00380 Tryptophan metabolism
    GTCCBUS3UF5_23130
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    GTCCBUS3UF5_23130
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    GTCCBUS3UF5_23130
   00281 Geraniol degradation
    GTCCBUS3UF5_23130
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GTCCBUS3UF5_23130
   00627 Aminobenzoate degradation
    GTCCBUS3UF5_23130
   00930 Caprolactam degradation
    GTCCBUS3UF5_23130
Enzymes [BR:gte01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     GTCCBUS3UF5_23130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AEV19619
UniProt: G8MY58
Position
complement(2129787..2130563)
Genome map
AA seq 258 aa AA seqDB search
MSEFVSIAARQEGAVGIIELARPDVLNALSRQMVAEIVAAVEAFDRNEKVRVIVLTGRGR
AFAAGADIQEMAKDDPIRLEWLNQFADWDRLSIVKTPMIAAVNGLALGGGFELALSCDLI
VASSAAEFGFPEVNLGVMPGAGGTQRLTKLIGPKRALEWLWTGARMSAKEAEQLGIVNRV
VSPELLMEETMRLAGRLAEQPPLALRLIKEAVQKAVDYPLYEGMQFERKNFYLLFASEDQ
KEGMAAFLEKRKPRFQGK
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagtttgtttccattgcggcgcgtcaagagggagcggtcggcatcatcgagctc
gcccgtcctgatgtattgaatgcgctgagccgtcaaatggtggcggaaatcgttgcggca
gtggaagcgtttgatcggaatgagaaggtgcgtgtcattgtgttgaccgggcgtggacgg
gcgtttgcggctggggcggatattcaagagatggcaaaagatgaccccattcgtcttgag
tggctgaaccagtttgccgattgggatcgcctgtccatcgtgaaaacgccgatgatcgcc
gctgtgaacgggttggcgctagggggaggttttgagctggcgctttcgtgcgacttgatt
gtcgcgtcgtcggcggccgaatttggctttccagaagtgaaccttggcgtcatgccaggt
gcgggaggcacgcagcggctgacaaagctcatcggtccgaagcgggcgctcgagtggctt
tggactggggcgcgtatgtcggcgaaagaagccgagcagctggggattgtcaaccgcgtc
gtcagcccggagcttttaatggaagaaacgatgaggctggccgggcgtctcgctgaacag
ccgcctttggctctccggctgatcaaagaggcggtgcagaaagcggtcgactatccgctg
tatgaaggcatgcaatttgagcggaaaaacttttacctattgttcgcctcggaagaccaa
aaagaaggaatggcggcattcctcgaaaaacgaaagccgcgcttccaaggaaaataa

DBGET integrated database retrieval system